DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001004886.1 Gene:c1galt1c1 / 448225 XenbaseID:XB-GENE-941230 Length:317 Species:Xenopus tropicalis


Alignment Length:305 Identity:74/305 - (24%)
Similarity:129/305 - (42%) Gaps:53/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYED 118
            |:|.....::.|::|..|:::...| :|.|||.:.|.:..:.|||..:      |.|.......|
 Frog    59 RLELSHSMQVYCIILVRPKDLSHWA-AVRETWSKHCDKADYYSSEPMK------VFESISVDTND 116

  Fly   119 LWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMS 183
            ||...|:..:..:|:....|:||......|:.|:|||::.|...||:.|.:.|:.:...::.|:.
 Frog   117 LWAMMRKAIQMTYENNKNAYNWFFICTPSTFAVIENLKYFLLQKDPSQPYYLGHTVKSGDLDYVD 181

  Fly   184 GGASYILSREALHRFATQAYESEVICPQPK----KMGIEDFYMGICMQNVGVHFVDSTHALDGDT 244
            .....:||.|:|||..:...|.|. ||:..    ||. ||..:.:|::..||.   :.:|.|.:.
 Frog   182 IAGGIVLSIESLHRLFSIFKEPEK-CPEQGGLIFKMS-EDKQLAMCLKYKGVL---AENAEDSEG 241

  Fly   245 KPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLK 309
            |..|....:...:.:.....|:        :|..|  |||:.::.|...|...|.:..:.:|.|:
 Frog   242 KNVFNTKSVGTLIQETMANNPQ--------KVVEG--CCSDMAITFSGISPNFMHVMMYGVYRLR 296

  Fly   310 VFDPNQISERGHRSRLTLSDLTRRFPLEDNSNIKDLLQMSEKPDN 354
            .:        ||                   :..|.|....|||:
 Frog   297 AY--------GH-------------------SFNDALVFHPKPDS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 42/152 (28%)
c1galt1c1NP_001004886.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.