DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and B3glct

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_030110487.1 Gene:B3glct / 381694 MGIID:2685903 Length:582 Species:Mus musculus


Alignment Length:284 Identity:69/284 - (24%)
Similarity:108/284 - (38%) Gaps:65/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FMAGFVLAFVLL-------------------------LYVYDVS---RVTP----CWSSTS--TM 47
            |.||:.|:..|:                         ||::|..   .:||    |.....  .:
Mouse   270 FAAGWALSIPLVNKLAKRLKSEALKSDFTIDLKHEIALYIWDKGGGPALTPVPEFCTEDVDPRCV 334

  Fly    48 TTATTARIEDGPPPR---ILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGV- 108
            ||..:.....|.|.:   |...|.||.:........|.:||..:.|.:.:.|  ||....:..| 
Mouse   335 TTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYS--DYAETAIPTVD 397

  Fly   109 --VEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVF-- 169
              :..|..|:   ..||.........|......|.:..||||.:.:..|:|||..:|.:.|||  
Mouse   398 LGIPNTDRGH---CGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLG 459

  Fly   170 --FGYKMSRYNVSYMSGGASYILSREALHRF---ATQAYESEVICPQPKKMGIEDFYMGICMQNV 229
              :||.:.....||::||...:.||||:.|.   :.:.|.::.    |     :|..:|:|...:
Mouse   460 ERYGYGLGTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDA----P-----DDMVLGMCFSGL 515

  Fly   230 GVHFVDSTHA-LDGDTKPKFMPLD 252
            |   |..||: |....:|...|.|
Mouse   516 G---VPVTHSPLFHQARPVDYPKD 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/158 (25%)
B3glctXP_030110487.1 Galactosyl_T 348..550 CDD:389837 54/206 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.