DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and CG9109

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster


Alignment Length:160 Identity:37/160 - (23%)
Similarity:56/160 - (35%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 DYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNV--------------------SY 181
            |..|.:..||||.:.:    ||:....|.:.......:.|:|.                    :|
  Fly   348 DIRWLMLVDDDTLLSL----HLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNY 408

  Fly   182 MSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGV---HFVDSTHALDGD 243
            .:|||..:||. .|.|...|.      |..|.....:|..:|.|:|.:||   |......|...|
  Fly   409 HTGGAGIVLSL-PLVRLIVQR------CSCPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQD 466

  Fly   244 TKPKFM----PLDLENYM-SDANYTIPEWL 268
            ...:.:    ||....:. :|..:|...||
  Fly   467 YAGELLQLHAPLTFHKFWNTDPEHTYRRWL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 29/120 (24%)
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.