DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and c1galt1b

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_956345.1 Gene:c1galt1b / 337131 ZFINID:ZDB-GENE-030131-9075 Length:374 Species:Danio rerio


Alignment Length:296 Identity:103/296 - (34%)
Similarity:159/296 - (53%) Gaps:26/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            ||||.|:|.|:|::..||.|..||.:.|:.::|.||.|......||:  .|..|.:.|:.||...
Zfish    88 RILCWVMTGPDNLEKKARHVKATWSRHCNIVVFISSVDNPDFPTVGL--NTKEGRDQLYWKTIRA 150

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGASYIL 190
            |.:|.|.::.:.||||||||||||:::||:.:|....|..||:||.:...| ...||||||.|:|
Zfish   151 FHYVMEKHSDEADWFLKADDDTYVIVDNLRWILARHSPEDPVYFGRRFKPYVKQGYMSGGAGYVL 215

  Fly   191 SREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLEN 255
            |:|||.|| .:.:.::| |..  ...:||..||.||:.:||...||...:..:|...|:|   |:
Zfish   216 SKEALRRF-VEGFRTKV-CTH--TTSVEDLAMGQCMEKIGVKAGDSRDTMQRETFHPFVP---ES 273

  Fly   256 YMSDANYTIPE--WLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISE 318
            :::.   |.|:  |........:..|..|||:.:|:|||.....|:|.|:..|||:.|       
Zfish   274 HLTG---TFPKTFWYWNYCYYPIVQGPQCCSDLAVSFHYVDASHMYLLEYYTYHLRAF------- 328

  Fly   319 RGHRSRLTLSDLTRRFPLEDNSNI---KDLLQMSEK 351
             |::.|....:...:.|.:..:.:   ||.::..|:
Zfish   329 -GYKYRYQPPEPNVKAPEKVETRVLEQKDKVEAQEE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 60/149 (40%)
c1galt1bNP_956345.1 Galactosyl_T 107..274 CDD:304462 69/175 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..374 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.