DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and CG18558

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_608720.2 Gene:CG18558 / 33482 FlyBaseID:FBgn0031469 Length:588 Species:Drosophila melanogaster


Alignment Length:332 Identity:110/332 - (33%)
Similarity:164/332 - (49%) Gaps:42/332 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MAGFVLAFVLLLYVYDVSRVTPC--WSSTSTMTTATTARIEDG------PPPRILCMVLTCPENV 74
            |..:||.| ||.::.....:||.  ..|.:.:|...:..:.|.      ...||:|:|||.|:..
  Fly   270 MQMYVLEF-LLYHLRPYGHLTPLPELRSPNPLTKIASRPLNDQLAKMMYRSVRIICLVLTWPKKY 333

  Fly    75 QSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYED----LWNKTREGFRHVWEHYA 135
            .|.||::.||||:.|:|:|:..|   .|...:..:|..|....|    ||.||:..|||.:.:|.
  Fly   334 MSGARAISETWGRHCNRVIYYGS---FPGTTISGLEIVGLNASDTRSKLWGKTKAAFRHAYRNYG 395

  Fly   136 GDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYILSREALHRFAT 200
            .:.|||.|||||||.||||::.||:.:.|:.|::||......:..||||||.|:||:.|:.....
  Fly   396 HEVDWFYKADDDTYAVMENMRKLLKPYSPSNPIYFGSPFKLGSTLYMSGGAGYVLSKSAVELLNL 460

  Fly   201 QAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYTIP 265
            .|.|:   | ||...|.||:.||.|:..:.|...||...|.   :.:|..|.||:::      ||
  Fly   461 GAAEN---C-QPGDQGTEDYVMGKCLSLLQVQAGDSRDLLG---RQRFFSLSLEHFL------IP 512

  Fly   266 E------WLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF-------DPNQIS 317
            .      ||:........|||.|||.||::.|..|...|...|.::|..:.:       .|.::|
  Fly   513 NRDDEGFWLQEYLYQTTGTGLECCSTYSISIHNVSPYEMHFLETILYKRRPYGLLAGHAPPRRLS 577

  Fly   318 ERGHRSR 324
            :...|.:
  Fly   578 KNRLRKQ 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 59/152 (39%)
CG18558NP_608720.2 Galactosyl_T <400..>458 CDD:304462 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458866
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.