DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and tgy

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster


Alignment Length:263 Identity:99/263 - (37%)
Similarity:148/263 - (56%) Gaps:12/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            |:||.|||.|:..::.|..|..|||:||:::.|.:||..:.|..|.:.:|  ..||.||.||:|.
  Fly    98 RVLCWVLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDELPTVVLTKP--DRYEMLWGKTKEA 160

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFG--YKM---SRYNVSYMSGGA 186
            |.|:.|....:.|||:|||||||:.:|||:::|..:.|.||::||  |||   .:.|.||||||:
  Fly   161 FVHIHEQMRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFGFNYKMVGTHQKNESYMSGGS 225

  Fly   187 SYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPL 251
            .|:||||||..|| :.......|.|..... ||..||.|:.|:||...||.   |...:.:|.|:
  Fly   226 GYVLSREALRIFA-EGVNDTTKCRQEDDHA-EDVEMGKCLFNLGVKAGDSR---DEQLRNRFYPI 285

  Fly   252 DLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQI 316
            .....:...|..:..||...:.....:.:.|.|.|.|||||...:::::|::..|..::....|:
  Fly   286 APYGALLSGNVGMDFWLYKYAYYNPRSCMDCLSEYPVAFHYVHSKQLYVYDYFNYQFQLSGRAQV 350

  Fly   317 SER 319
            :||
  Fly   351 AER 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 67/153 (44%)
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 75/170 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.