DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_955961.2 Gene:c1galt1c1 / 324052 ZFINID:ZDB-GENE-030131-2772 Length:317 Species:Danio rerio


Alignment Length:284 Identity:70/284 - (24%)
Similarity:135/284 - (47%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            |:.|:::..|:.:...| :..:||.:.|.:.:|.:||..:.|..|.:.|      :|.|.:.|:.
Zfish    68 RVYCLIMVTPKLLVHWA-TANDTWSKHCDKSVFYTSEASKALDAVDLQE------QDEWTRLRKA 125

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYILS 191
            .:|.:|: |||..||..|...|:.::|||::|:...||:.|.:.|:......:.|:...:..:||
Zfish   126 IQHAYEN-AGDLHWFFIARPTTFAIIENLKYLVLDKDPSQPFYIGHTEKSGELDYVEYDSGIVLS 189

  Fly   192 REALHRFATQAYESEVICPQPK----KMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLD 252
            .||:.|. .:.::.|..||:..    ||. |:..:..|::..|| |.::..  |...|..|....
Zfish   190 YEAMRRL-MEVFKDEDKCPERGRALWKMS-EEKQLATCLKYSGV-FAENGE--DAQGKGLFNKKS 249

  Fly   253 LENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQIS 317
            :.:.:||:          :|.:..:...||||:.::.|...|..::.:..:.:|.|:.:      
Zfish   250 VSSLISDS----------ISQNPGDVVEACCSDMAITFAGMSPSQIQVLMYGVYRLRPY------ 298

  Fly   318 ERGHRSRLTLSDLTRRFPLEDNSN 341
              ||....:|:.|    |.:|:.|
Zfish   299 --GHDFHDSLTFL----PPKDSDN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 43/152 (28%)
c1galt1c1NP_955961.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.