DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and F37A4.3

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 / 185403 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans


Alignment Length:212 Identity:41/212 - (19%)
Similarity:72/212 - (33%) Gaps:78/212 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 WFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYILSREALHRFATQAYE 204
            |::.|.|:.|..:|.|...|..||.:.|:        |.:                         
 Worm   109 WYMFAFDNNYFFVERLIKELSKFDSHLPI--------YTI------------------------- 140

  Fly   205 SEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWL- 268
                        :.||:..|..:.|   .:.|..||:     .|..|:.||...:|. .:.||| 
 Worm   141 ------------LRDFHADIQHKPV---LIFSRSALN-----TFYDLEEENCSENAE-NVEEWLT 184

  Fly   269 RLMSLSRVETGLACCSNYSVAFHYASRERMFLYE--FLIYHLKVFDPNQISERG---HRSRLTLS 328
            ..||:..:          :::...:.:.|:|..:  |.:..:|.. ||...:..   ||...:|.
 Worm   185 TCMSIPPI----------TISVDRSKKSRIFAIKRHFQVDEMKTM-PNDYHDDKDYIHRHSSSLL 238

  Fly   329 DLTRRFPLEDNSNIKDL 345
            ..|       |.:::||
 Worm   239 SFT-------NLSLEDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 15/94 (16%)
F37A4.3NP_498472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.