DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and B3GLCT

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT / 145173 HGNCID:20207 Length:498 Species:Homo sapiens


Alignment Length:215 Identity:55/215 - (25%)
Similarity:88/215 - (40%) Gaps:47/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGV---VEPTGGGY-------- 116
            |...|.||.:........|.:||..:.|.:.:.|  ||....:..|   :..|..|:        
Human   269 IFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYS--DYTENSIPTVDLGIPNTDRGHCGKTFAIL 331

  Fly   117 EDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVF----FGYKMSRY 177
            |...|::::           ...|.:..||||.:.:..|||||..:|...|||    :||.:...
Human   332 ERFLNRSQD-----------KTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLGERYGYGLGTG 385

  Fly   178 NVSYMSGGASYILSREALHRFAT---QAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHA 239
            ..||::||...:.||||:.|...   :.|.::.    |     :|..:|:|...:|   :..||:
Human   386 GYSYITGGGGMVFSREAVRRLLASKCRCYSNDA----P-----DDMVLGMCFSGLG---IPVTHS 438

  Fly   240 -LDGDTKPKFMPLDLENYMS 258
             |....:|...|.|   |:|
Human   439 PLFHQARPVDYPKD---YLS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/166 (24%)
B3GLCTNP_919299.3 Galactosyl_T 264..467 CDD:304462 55/215 (26%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.