DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Duox and FRO1

DIOPT Version :9

Sequence 1:NP_001259968.1 Gene:Duox / 33477 FlyBaseID:FBgn0283531 Length:1537 Species:Drosophila melanogaster
Sequence 2:NP_171665.1 Gene:FRO1 / 837194 AraportID:AT1G01590 Length:704 Species:Arabidopsis thaliana


Alignment Length:696 Identity:136/696 - (19%)
Similarity:227/696 - (32%) Gaps:265/696 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   989 TSTNVARMTSFNIEPMQDKPRHWLLAKWDAYITFLEENRQ------------------------- 1028
            |.|.|..:|.|....:      |.||.: .|.||:....:                         
plant   120 TVTEVMFLTMFMALLL------WSLANY-MYRTFVNVTSESAATDGNNLWQARLDLIAVRIGIVG 177

  Fly  1029 NIFYLFLFYVV--------TIVLFVERFIHYSFMAEHTDLRHIMGVGIAITRGSAASLSFCYSLL 1085
            ||...||||.|        .:.|..|..|.|     |..|.|:  |.|..|     |...||  .
plant   178 NICLAFLFYPVARGSSLLAAVGLTSESSIKY-----HIWLGHL--VMIIFT-----SHGLCY--F 228

  Fly  1086 LLTMSRN-LITKLKEFPIQQYIPLDSHIQFHKIAACTALFFSVLHTVGHIVNFYHVSTQSHENLR 1149
            :..:|:| |::|:.|                                                  
plant   229 IYWISKNQLVSKMLE-------------------------------------------------- 243

  Fly  1150 CLTREVHFASDYKPDITFWLFQTVTGTTGVMLFIIMCIIFVFAHPTIRKKAYNFFWNMHTLYIGL 1214
                              |....|:...|.:..:...:::|..:|.||::.:..|:..|.|||..
plant   244 ------------------WDRTAVSNLAGEIALVAGLMMWVTTYPKIRRRLFEVFFYSHYLYIVF 290

  Fly  1215 YLLSLIH-GLARLTGP-PRFWMFFLGPGIVYTLDKIVSLRTKYMALDVIDTDLLPSDVIKIKFYR 1277
            .|..:.| |::....| |.|::|.        :|:.:........:.::...:||.|.:::.|.:
plant   291 MLFFVFHVGISHALIPLPGFYIFL--------VDRFLRFLQSRNNVKLVSARVLPCDTVELNFSK 347

  Fly  1278 PPNLKYLSGQWVRLSCTAFRPHEMHSFTLTSAP--HENFLSCHIKAQGPWTWKLRNYFDPCNYNP 1340
            .|.|.|.....:.::..:....:.|.||:.|:.  ....||..||:||.|:.||   :|..:.:.
plant   348 NPMLMYSPTSTMFVNIPSISKLQWHPFTIISSSKLEPETLSVMIKSQGKWSTKL---YDMLSSSS 409

  Fly  1341 EDQPK---IRIEGPFGGGNQDWYKFEVAVMVGGGIGVTPYASILNDLVFGTSTNRYSGVACKKVY 1402
            .||..   :.:|||:|..:.|:.:.|..|||.||.|:||:.||:.||.:.:||::     ||...
plant   410 SDQINRLAVSVEGPYGPSSTDFLRHESLVMVSGGSGITPFISIVRDLFYMSSTHK-----CKIPK 469

  Fly  1403 FLWICPSHKHFEW------------------FID--VLRDVEKKDVTNVLE-------------- 1433
            ...||......:.                  |:|  :...|.:::.|:|.|              
plant   470 MTLICAFKNSSDLSMLDLILPTSGLTTDMASFVDIQIKAFVTREEKTSVKESTHNRNIIKTRHFK 534

  Fly  1434 ---------------------------------IHIFITQF-FHKFDLRT---TMLYICENHFQR 1461
                                             |...||:: .|..|..:   |..|....:...
plant   535 PNVSDQPISPILGPNSWLCLAAILSSSFMIFIVIIAIITRYHIHPIDQNSEKYTWAYKSLIYLVS 599

  Fly  1462 LSKTSIFTGLKAV------------------------------------NHFG-RPDMSSFLKFV 1489
            :|.|.:.|...|:                                    .|:| ||:::..|..:
plant   600 ISITVVTTSTAAMLWNKKKYYAKNDQYVDNLSPVIIESSPQQLISQSTDIHYGERPNLNKLLVGL 664

  Fly  1490 QKKHSYVSKIGVFSCGPRPLTKSVMSACDEVNKTRKLPYFIHHFEN 1535
            :.     |.:|:..|||:.:.:.|...| .......|     |||:
plant   665 KG-----SSVGILVCGPKKMRQKVAKIC-SFGSAENL-----HFES 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DuoxNP_001259968.1 An_peroxidase 70..580 CDD:281139
dual_peroxidase_like 72..625 CDD:188652
EFh 827..882 CDD:238008
EFh 860..921 CDD:238008
EF-hand_7 860..920 CDD:290234
EFh 895..966 CDD:238008
EF-hand_7 899..965 CDD:290234
Ferric_reduct 1084..1217 CDD:280043 17/133 (13%)
NOX_Duox_like_FAD_NADP 1265..1536 CDD:99783 80/384 (21%)
FRO1NP_171665.1 PLN02292 1..704 CDD:215165 136/696 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000155
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.