DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Duox and NOX4

DIOPT Version :9

Sequence 1:NP_001259968.1 Gene:Duox / 33477 FlyBaseID:FBgn0283531 Length:1537 Species:Drosophila melanogaster
Sequence 2:NP_001278856.1 Gene:NOX4 / 50507 HGNCID:7891 Length:599 Species:Homo sapiens


Alignment Length:606 Identity:155/606 - (25%)
Similarity:250/606 - (41%) Gaps:151/606 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1034 FLFYVVTIVLFVERFIHYSFMAEHTDLRHIMGVGIAITRGSAASLSFCYSLLLLTMSRNLITKLK 1098
            |::..:.::||.:.|:.|:...|:..|..::|:|:.::|.||:.|:...||:||.|.|.|:..|:
Human    41 FIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSLILLPMCRTLLAYLR 105

  Fly  1099 EFPIQQYIP-------LDSHIQFHKIAACTALFFSVLHTVGHIVNFYHVSTQSHENLRCLTREVH 1156
            .   .|.:|       ||....||.....|...||.:|...|:||..:.|....|:.    .|::
Human   106 G---SQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDF----VELN 163

  Fly  1157 FASDYKPDITFWLFQTVTGTTGVMLFIIMCIIFVFAHPTIRKKAYNFFWNMHTLYIGLYLLSLIH 1221
            .|.....|....||.||.|.|||.:.:::.::...:...||...|:.||..|.|:...|:|..:|
Human   164 AARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLH 228

  Fly  1222 ---GLARL-----TGP------------------------------------------------- 1229
               ||.:.     |.|                                                 
Human   229 VSGGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICME 293

  Fly  1230 -PRF-------WMFFLGPGIVYTLDKIVSLRTKYMALDVIDTDLLPSDVIKIKFYRPPNLKYLSG 1286
             |||       |::..||..:|..:::.........:.:|.....||||::|:..: .|.|...|
Human   294 EPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVK-ENFKARPG 357

  Fly  1287 QWVRLSCTAFRPHEMHSFTLTSAPHEN--FLSCHIKAQGPWTWKLRNYFDPCNYNPEDQ------ 1343
            |::.|.|.:....|.|.||||..|.|.  ....|:|..|.||.:.|:...|    |..|      
Human   358 QYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLP----PSSQDSEILP 418

  Fly  1344 -------PKIRIEGPFGGGNQDWYKFEVAVMVGGGIGVTPYASILNDLVFGTSTNRYSGVACKKV 1401
                   ||:.|:||||...::...:||::.|.|||||||:|||||.|:     :.:.....:::
Human   419 FIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLL-----DDWKPYKLRRL 478

  Fly  1402 YFLWICPSHKHFEWFIDVLRDVEKK-------DVTNVLEIHIFITQ-------FFHKFDLRTTML 1452
            ||:|:|...:.|.||.|:|..:..|       |..|   |.::::|       ...|:....:.|
Human   479 YFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVN---IQLYLSQTDGIQKIIGEKYHALNSRL 540

  Fly  1453 YICENHFQRLSKTSIFTGLKAVNHFGRPDMSSFLKFVQKKHSYVSKIGVFSCGPRPLTKSVMSAC 1517
            :|                       |||........: .|::....:|||.|||..|:|::....
Human   541 FI-----------------------GRPRWKLLFDEI-AKYNRGKTVGVFCCGPNSLSKTLHKLS 581

  Fly  1518 DEVNK--TRKLPYFIHHFENF 1536
            ::.|.  ||    |.::.|:|
Human   582 NQNNSYGTR----FEYNKESF 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DuoxNP_001259968.1 An_peroxidase 70..580 CDD:281139
dual_peroxidase_like 72..625 CDD:188652
EFh 827..882 CDD:238008
EFh 860..921 CDD:238008
EF-hand_7 860..920 CDD:290234
EFh 895..966 CDD:238008
EF-hand_7 899..965 CDD:290234
Ferric_reduct 1084..1217 CDD:280043 41/139 (29%)
NOX_Duox_like_FAD_NADP 1265..1536 CDD:99783 85/301 (28%)
NOX4NP_001278856.1 Ferric_reduct 90..225 CDD:280043 42/141 (30%)
NOX_Duox_like_FAD_NADP 332..598 CDD:99783 86/306 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000155
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.