DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G6P and G6PC2

DIOPT Version :9

Sequence 1:NP_001097063.1 Gene:G6P / 33476 FlyBaseID:FBgn0031463 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_066999.1 Gene:G6PC2 / 57818 HGNCID:28906 Length:355 Species:Homo sapiens


Alignment Length:362 Identity:100/362 - (27%)
Similarity:159/362 - (43%) Gaps:53/362 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVHILSD--AYHTTLTRELFINEWAQERLSFGRPLWHFLSVHLEPNKMFNIIIPLCGIFSQEILV 66
            |.|:..|  ||:|      |:|               |:|...:|..:|.|..|||..|:|.:..
Human    12 IQHLQKDYRAYYT------FLN---------------FMSNVGDPRNIFFIYFPLCFQFNQTVGT 55

  Fly    67 HLFTAFTLISTLNSFEKWIYPETRPLWFLREQFANNVVVKKPAVALESHQLSCEMTGGLPCAHSM 131
            .:.....:...||...|||....||.|:::|   ..:.....:..||....:||...|.|..|:|
Human    56 KMIWVAVIGDWLNLIFKWILFGHRPYWWVQE---TQIYPNHSSPCLEQFPTTCETGPGSPSGHAM 117

  Fly   132 --TFTVFVLILASFFFVHC-WDRFA----ALRSSFCRCIMYLLIIGMVVCMWLSRLYLATEFLHQ 189
              :...:|::.|:.....| .|:|:    .|..||...:.:|:.|.  ||  :||:::||.|.||
Human   118 GASCVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQIS--VC--ISRVFIATHFPHQ 178

  Fly   190 CILGSYLGIRSLCTFEGNVKYLFSRPRRYAVSAVF-FLGGLALSVYYVKLELNIDPHWSVREAFK 253
            .|||...|:.....||.......:....|..:.:| ||  .|:..|.:...||||..|||..|.|
Human   179 VILGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFL--FAVGFYLLLRVLNIDLLWSVPIAKK 241

  Fly   254 WCPEPTYLRHEVGPIFALVRDLGNLMGL--ALASPLYKLEMKQS-----SFWRRCRF--LGVLEF 309
            ||..|.::..:..|...|||:||.|.||  |:.|.::.|..:..     ||...|..  |.:|:.
Human   242 WCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTSLTILQL 306

  Fly   310 VNYGLRFSTFKQSGRFVFLTYEFLRNVIHSLVLIKYV 346
            .:: |:..|.::   .:|....|.::....|.::.::
Human   307 YHF-LQIPTHEE---HLFYVLSFCKSASIPLTVVAFI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G6PNP_001097063.1 PAP2_glucose_6_phosphatase 49..290 CDD:239476 78/250 (31%)
G6PC2NP_066999.1 PAP2_glucose_6_phosphatase 38..278 CDD:239476 78/248 (31%)
Prevents secretion from ER. /evidence=ECO:0000255 352..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146785
Domainoid 1 1.000 52 1.000 Domainoid score I11461
eggNOG 1 0.900 - - E1_2CMVX
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I5024
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49592
OrthoDB 1 1.010 - - D325559at33208
OrthoFinder 1 1.000 - - FOG0001425
OrthoInspector 1 1.000 - - otm42077
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12591
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11645
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.