DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G6P and LOC108350389

DIOPT Version :9

Sequence 1:NP_001097063.1 Gene:G6P / 33476 FlyBaseID:FBgn0031463 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_038962290.1 Gene:LOC108350389 / 108350389 RGDID:11401035 Length:79 Species:Rattus norvegicus


Alignment Length:41 Identity:12/41 - (29%)
Similarity:17/41 - (41%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KWIYPETRPLWFLREQFANNVVVKKPAVALESHQLSCEMTG 123
            |||.....|.|:::|   ..:.....:..||.....|| ||
  Rat    16 KWILSGHCPYWWIQE---TEIYPNHSSPCLEQIPTPCE-TG 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G6PNP_001097063.1 PAP2_glucose_6_phosphatase 49..290 CDD:239476 12/41 (29%)
LOC108350389XP_038962290.1 PAP2_like 1..>55 CDD:412398 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325559at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.