powered by:
Protein Alignment G6P and LOC108350389
DIOPT Version :9
Sequence 1: | NP_001097063.1 |
Gene: | G6P / 33476 |
FlyBaseID: | FBgn0031463 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038962290.1 |
Gene: | LOC108350389 / 108350389 |
RGDID: | 11401035 |
Length: | 79 |
Species: | Rattus norvegicus |
Alignment Length: | 41 |
Identity: | 12/41 - (29%) |
Similarity: | 17/41 - (41%) |
Gaps: | 4/41 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 KWIYPETRPLWFLREQFANNVVVKKPAVALESHQLSCEMTG 123
|||.....|.|:::| ..:.....:..||.....|| ||
Rat 16 KWILSGHCPYWWIQE---TEIYPNHSSPCLEQIPTPCE-TG 52
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D325559at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.