DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2964 and AT3G49160

DIOPT Version :9

Sequence 1:NP_608713.2 Gene:CG2964 / 33475 FlyBaseID:FBgn0031462 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_190485.1 Gene:AT3G49160 / 824077 AraportID:AT3G49160 Length:710 Species:Arabidopsis thaliana


Alignment Length:366 Identity:97/366 - (26%)
Similarity:162/366 - (44%) Gaps:52/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VSLIATISVSSRN-------ADTIYTMIMRGVNIFRLNFSHESHEMHSKTIELINEALERIHKET 91
            ||..|||||..::       .|:|.....|| ...||..|.|.|..:|  ...:.|..:..:.|:
plant   348 VSPDATISVQGQDFLAGLQIGDSIRLCDARG-RKRRLKISKEFHVFNS--TGFVAECFDTAYIES 409

  Fly    92 GQIRTVAIAADTRGPQIRTGLLD-----GDVFLRSGDNLRLSINRDLYDKGNKEAVYVDYPNIIN 151
            |   |.......:|.::...::|     ..|.|:.||  .|.|.|:    |:.:...|..|....
plant   410 G---TELSVKGKKGRRLVGRVVDVPPKESFVRLKVGD--LLVITRE----GSLDEPSVTVPGAHR 465

  Fly   152 LT----------KTGDRLFIDDGRLLLHILEVGVDGLLCEVIH----GGQLNNNCNVILPEIEID 202
            ||          |.|:.:..|||::...|.......::..:.|    |.:|.:..::.:|:.:|.
plant   466 LTCPSGYLFDSVKPGETIGFDDGKIWGVIKGTSPSEVIVSITHARPKGTKLGSEKSINIPQSDIH 530

  Fly   203 LPAVSEKDMFDIQFSIKANVDFLFASAVRSAKNVKELRTVLGE-KGKHIKIIAKMDSKIALSRFS 266
            ...::.||:.|:.: :.::.|.:..|.:|...::..||..|.: |...:.|:.|:::|......|
plant   531 FKGLTSKDIKDLDY-VASHADMVGISFIRDVHDITVLRQELKKRKLDDLGIVLKIETKSGFKNLS 594

  Fly   267 EILRAAD------GLLLSRADLGTQIPIEKLFITQKSILGQCNKVGKPVIVASHILESMRTLPHP 325
            .||..|.      |::::|.||..:...|:|...|:.|:..|.....|||:|:.:|||:.....|
plant   595 LILLEAMKCSNPLGIMIARGDLAVECGWERLANMQEEIIAICKAARVPVIMATQVLESLVKSGVP 659

  Fly   326 TRAECFDLANAIIDGADCIMLSSEVAIGSFPKETVATCDTL 366
            ||||..|.|||  ..|.|:||:.    |....|.|:..||:
plant   660 TRAEITDAANA--KRASCVMLNK----GKNIVEAVSMLDTI 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2964NP_608713.2 Pyruvate_Kinase 32..515 CDD:304951 97/366 (27%)
pyruv_kin 32..512 CDD:273424 97/366 (27%)
AT3G49160NP_190485.1 Pyruvate_Kinase 94..695 CDD:304951 97/366 (27%)
PRK08187 106..695 CDD:236178 97/366 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11817
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.