DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and GDF3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_065685.1 Gene:GDF3 / 9573 HGNCID:4218 Length:364 Species:Homo sapiens


Alignment Length:268 Identity:50/268 - (18%)
Similarity:117/268 - (43%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 SVNSTSAQQTIVVSEVEVDQQKDSKY-LSAAKTIAIQSVNVQDEWMKI-----------DIEWPI 418
            ::::...::.:.::::.:|...:|.| |.....:|:..|.....|.:.           .:.|| 
Human   112 NLSAIKEREQLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWP- 175

  Fly   419 KHWISGHELSHLIQITCGGCDVSD---------MEEIISVDKD----YRP--------------F 456
                .|....:|:.:   ..|.:|         :|.::..|:|    ::|              .
Human   176 ----QGAVHFNLLDV---AKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASL 233

  Fly   457 IVIDMQ-NRRRKSRQKRS------INCSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRG 514
            :|:.:. ::...||::|:      ::|.:   .|.|..|:|:|||:||..||:.|:|:.|.:|.|
Human   234 LVVTLNPDQCHPSRKRRAAIPVPKLSCKN---LCHRHQLFINFRDLGWHKWIIAPKGFMANYCHG 295

  Fly   515 SCSSVASVTQAASHHSSIMKILSTSGANKSLELVP--CCTAKQYSSLQLVVMDSSNTATVKTLPN 577
            .|....:::..:|:::.:..::......     :|  .|...:.|.:.::..|:::...::...:
Human   296 ECPFSLTISLNSSNYAFMQALMHAVDPE-----IPQAVCIPTKLSPISMLYQDNNDNVILRHYED 355

  Fly   578 MVVESCGC 585
            |||:.|||
Human   356 MVVDECGC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 17/130 (13%)
TGF_beta 481..585 CDD:278448 26/105 (25%)
GDF3NP_065685.1 TGFb_propeptide <109..220 CDD:279078 17/115 (15%)
TGFB 264..364 CDD:214556 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.