DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and MCM3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_010882.1 Gene:MCM3 / 856680 SGDID:S000000758 Length:971 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:50/270 - (18%)
Similarity:92/270 - (34%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PITKREYYARLRRHVIHKRQHLL-----------------------------QQELSYNHPGSHS 121
            |||.|.....:|....|.:..|.                             ::|..|....|..
Yeast   696 PITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKR 760

  Fly   122 EQLKVPRLWQHLMEQEEKAHRHVSPPVELPIMYGDAPEESSLSSDDHFDDLSPLDFVRNELMAED 186
            ...|.|:..|.:.:....:    ..|::      ..|..|:.||    .:.:|....|.....:|
Yeast   761 SPQKSPKKRQRVRQPASNS----GSPIK------STPRRSTASS----VNATPSSARRILRFQDD 811

  Fly   187 QQNQ-EKDLDLDLDLDQQPETPIEPELPLGER-------NITISVKSSAG-----GCPKCESNRQ 238
            :||. |.|.|:...|....|..::..|.||.|       ::....:.|:|     |.|:..:...
Yeast   812 EQNAGEDDNDIMSPLPADEEAELQRRLQLGLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSS 876

  Fly   239 VEHITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDS---TKNKELDD 300
            .....|:|.:.:..:.|:...:...||.....:.|..:...||:  ..|:|..|   ..|:||.:
Yeast   877 AGQDDEQQQSVISFDNVEPGTISTGRLSLISGIIARLMQTEIFE--EESYPVASLFERINEELPE 939

  Fly   301 YYARTSKKFI 310
            ....::::::
Yeast   940 EEKFSAQEYL 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 14/70 (20%)
TGF_beta 481..585 CDD:278448
MCM3NP_010882.1 MCM_N 25..>137 CDD:405270
MCM 166..738 CDD:214631 7/41 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.807993 Normalized mean entropy S5
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.