Sequence 1: | NP_001259967.1 | Gene: | daw / 33474 | FlyBaseID: | FBgn0031461 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010882.1 | Gene: | MCM3 / 856680 | SGDID: | S000000758 | Length: | 971 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 270 | Identity: | 50/270 - (18%) |
---|---|---|---|
Similarity: | 92/270 - (34%) | Gaps: | 61/270 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 PITKREYYARLRRHVIHKRQHLL-----------------------------QQELSYNHPGSHS 121
Fly 122 EQLKVPRLWQHLMEQEEKAHRHVSPPVELPIMYGDAPEESSLSSDDHFDDLSPLDFVRNELMAED 186
Fly 187 QQNQ-EKDLDLDLDLDQQPETPIEPELPLGER-------NITISVKSSAG-----GCPKCESNRQ 238
Fly 239 VEHITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDS---TKNKELDD 300
Fly 301 YYARTSKKFI 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
daw | NP_001259967.1 | TGFb_propeptide | 244..458 | CDD:279078 | 14/70 (20%) |
TGF_beta | 481..585 | CDD:278448 | |||
MCM3 | NP_010882.1 | MCM_N | 25..>137 | CDD:405270 | |
MCM | 166..738 | CDD:214631 | 7/41 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.807993 | Normalized mean entropy | S5 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |