DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Inhbe

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_114003.2 Gene:Inhbe / 83711 RGDID:621196 Length:350 Species:Rattus norvegicus


Alignment Length:406 Identity:96/406 - (23%)
Similarity:151/406 - (37%) Gaps:118/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VKSSAGGCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLS 287
            |:|:...||.|.:    ..:|.:....|.:|..||||||.|.|...|:::.   |.|        
  Rat    19 VQSTRSACPSCGA----PTLTPQGERALVLELAKQQILEGLHLTSRPRITR---PLP-------- 68

  Fly   288 HPDDSTKNKELDDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVST--- 349
               .:...:.|.....|:   .:..|||:|             :.|...||.:.:....|.|   
  Rat    69 ---QAALTRALRRLQPRS---MVPGNREKV-------------ISFATSIDKSTSTYRSVLTFQL 114

  Fly   350 ----------AVLWLF-------------------KNKQNRTDTASVNSTSAQQTIVVSEVEVDQ 385
                      |.|||.                   :.:.:||..|...:||              
  Rat   115 SPLWSHHLYHARLWLHVPPSFPATLYLRIFGCGTTRCRGSRTFLADYQTTS-------------- 165

  Fly   386 QKDSKYLSAAKTIAIQSVNVQDE---WMKIDIEW-PIKHWISGHELSHLIQITCGGCDVSDMEEI 446
                   |....:.:.|..::.|   ..|:.:|: |:....:...|..|:..|.|          
  Rat   166 -------SGWHALTLPSSGLRSEESGVTKLQLEFRPLDLNSTTARLPRLLLDTAG---------- 213

  Fly   447 ISVDKDYRPFIVIDMQ-NRRRKSR-QKRSINCSSGMTECCREHLYISFRDIGWSNWILKPEGYNA 509
                 ..|||:.:.:: |.....| ::|:..|.|....|||...|:.|:::||.:|||:||||..
  Rat   214 -----QQRPFLELKIRANEPGAGRARRRTPTCESETPLCCRRDHYVDFQELGWRDWILQPEGYQL 273

  Fly   510 YFCRGSCSS--VASVTQAASHHSSIMKILSTSG---ANKSLELVPCCTAKQYSSLQLVVMDSSNT 569
            .:|.|.|..  ..|...|||.||::..:|..:.   |..|     ||.......|.|:.:|.:..
  Rat   274 NYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSS-----CCVPTARRPLSLLYLDHNGN 333

  Fly   570 ATVKTLPNMVVESCGC 585
            .....:|:||||:|||
  Rat   334 VVKTDVPDMVVEACGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 46/249 (18%)
TGF_beta 481..585 CDD:278448 37/108 (34%)
InhbeNP_114003.2 TGF_beta_INHBC_E 247..350 CDD:381676 39/108 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4723
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11848
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X477
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.