DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and bmp3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001071233.1 Gene:bmp3 / 777717 ZFINID:ZDB-GENE-030131-7192 Length:452 Species:Danio rerio


Alignment Length:401 Identity:82/401 - (20%)
Similarity:140/401 - (34%) Gaps:106/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 DDSTKNKELDDYYAR-TSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVL- 352
            :..|.::.:...||: ||..|.|.:...|...:...|..|......|.:... .:..||.:|.| 
Zfish    54 EQDTLSEHMQMLYAKYTSAGFPLKDGNTVRSFKGHLGTINNRQLQIFNLTSL-TKSEDVLSATLH 117

  Fly   353 WLFKNKQNRTDTASVNSTSAQQTI-VVSEVEVDQQKDSKYLSAAKTIAIQSVNVQD-EWMKIDIE 415
            :...:..|.:...|.:.:.||..: ..:.|.:|....|...:..:||....:|:.. .|..|..:
Zfish   118 YYIGDLHNSSHRCSKHKSCAQHNLRRQAHVHLDVWSFSLVKNTTRTIGHFPINISTMHWDFISWQ 182

  Fly   416 W--------PIKHW----------ISGH--------ELSHLIQITCGGCDVSDMEEIISVDKDYR 454
            |        ..||.          ..||        :.|..|.:......:|:.|.::|..:.::
Zfish   183 WKDITRVVNQAKHHDQLLIGININSRGHQPWKKLLSDRSPYILVYANDSAISEPESVVSTLQRHK 247

  Fly   455 PFI-----VIDMQNRRRKS--RQKRSINCSSGM-------------------------------- 480
            ..:     :::..||...:  |.:||.|....:                                
Zfish   248 SRLLPNLHMLESHNRNASAQHRSRRSTNILLPLQNNELPGPEYPYEIPTWDEASPYDPMESKTVK 312

  Fly   481 -----------------------------------TECCREHLYISFRDIGWSNWILKPEGYNAY 510
                                               ..|.|.:|.:.|.|||||.||:.|:.::||
Zfish   313 RPRKKPRKNPRHKNPLLQFDEQTIKKARKKQWNEPRNCARRYLKVDFADIGWSEWIISPKSFDAY 377

  Fly   511 FCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTL 575
            :|.|||......:...|:|::|..|:...|....:. .|||..::.|||.::..|......:|..
Zfish   378 YCSGSCQFPMPKSLKPSNHATIQSIVRAVGVVPGIP-EPCCVPEKMSSLSILFFDEDKNVVLKVY 441

  Fly   576 PNMVVESCGCR 586
            |||.|:||.||
Zfish   442 PNMTVDSCACR 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 37/202 (18%)
TGF_beta 481..585 CDD:278448 37/103 (36%)
bmp3NP_001071233.1 TGFB 350..452 CDD:214556 37/102 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.