DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and LEFTY2

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_003231.2 Gene:LEFTY2 / 7044 HGNCID:3122 Length:366 Species:Homo sapiens


Alignment Length:383 Identity:82/383 - (21%)
Similarity:145/383 - (37%) Gaps:90/383 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDG---------MTLSHPDDSTKNKE 297
            :|||||.        ..:|.:|:|.|.|.:...::.|.:...         :..||.|.| :.|.
Human    22 LTEEQLL--------GSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRS-RGKR 77

  Fly   298 LDDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLF-----KN 357
            ....:...:.:|:           |.:..::   ...|.::.......::..|||.||     |.
Human    78 FSQSFREVAGRFL-----------ASEASTH---LLVFGMEQRLPPNSELVQAVLRLFQEPVPKA 128

  Fly   358 KQNRTDTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQS--VNVQDE-WMKIDIEWPIK 419
            ..:|....|..|..|:.|:....|..|        .:.:|..|.|  |:|.:. |...|:...:.
Human   129 ALHRHGRLSPRSAQARVTVEWLRVRDD--------GSNRTSLIDSRLVSVHESGWKAFDVTEAVN 185

  Fly   420 HWISGHELSH-----LIQITCG----GCDVSDMEEIISVDKDYRP---------FIVIDMQNRRR 466
            .|   .:||.     |:|::..    |...|...:::.......|         ...:|:::...
Human   186 FW---QQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGA 247

  Fly   467 KSRQKRSINCSSGMTECCREHLYISFRDIGWS-NWILKPEGYNAYFCRGSCSSVASVTQAASHHS 530
            :.........:.| |.|||:.:||..:.:.|: ||:|:|.|:.||.|.|:|.   ...:|.:.:.
Human   248 QGDCDPEAPMTEG-TRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQ---QPPEALAFNW 308

  Fly   531 SIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTAT---VKTLPNMVVESCGC 585
            ..:      |..:       |.|.:.:||.::|.......|   |.:||||.|:.|.|
Human   309 PFL------GPRQ-------CIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 46/248 (19%)
TGF_beta 481..585 CDD:278448 32/107 (30%)
LEFTY2NP_003231.2 TGFb_propeptide <106..214 CDD:307025 26/118 (22%)
TGF_beta 263..353 CDD:306518 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.