DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and TGFB3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001316868.1 Gene:TGFB3 / 7043 HGNCID:11769 Length:412 Species:Homo sapiens


Alignment Length:414 Identity:95/414 - (22%)
Similarity:169/414 - (40%) Gaps:105/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 HITEEQLTHLRIEFVKQQILEKLRLKESPKVSAV-ELP----------KPIFDGMTLSHPDDSTK 294
            ||.::     |:|.::.|||.||||...|:.:.: .:|          :.:.:.|.....:..|:
Human    34 HIKKK-----RVEAIRGQILSKLRLTSPPEPTVMTHVPYQVLALYNSTRELLEEMHGEREEGCTQ 93

  Fly   295 NKELDDYYARTSKKFILL-----NREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWL 354
            .....:|||:...||.::     :.|...|     .|...|..|.|.:...:             
Human    94 ENTESEYYAKEIHKFDMIQGLAEHNELAVC-----PKGITSKVFRFNVSSVE------------- 140

  Fly   355 FKNKQN--RTD-----TASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQD--EWM 410
             ||:.|  |.:     ..:.:|...:|.|.:.::    .:..::::..:.|..:::..:.  ||:
Human   141 -KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQI----LRPDEHIAKQRYIGGKNLPTRGTAEWL 200

  Fly   411 KIDIEWPIKHWISGHELSHL---IQITC-------GGCDVSDMEEIISV---------------- 449
            ..|:...::.|:...| |:|   |.|.|       .|..:.::.|::.:                
Human   201 SFDVTDTVREWLLRRE-SNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDL 264

  Fly   450 -----DKD-YRPFIVIDM----------QNRRRKSRQKRSINCSSGMTE-CCREHLYISFR-DIG 496
                 .|| :.|.:::.|          |..:||.|...:..|...:.| ||...|||.|| |:|
Human   265 GRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLG 329

  Fly   497 WSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQL 561
            | .|:.:|:||.|.||.|.|..:.|   |.:.||:::.:.:|  .|......|||..:....|.:
Human   330 W-KWVHEPKGYYANFCSGPCPYLRS---ADTTHSTVLGLYNT--LNPEASASPCCVPQDLEPLTI 388

  Fly   562 VVMDSSNTATVKTLPNMVVESCGC 585
            :.. ...|..|:.|.||||:||.|
Human   389 LYY-VGRTPKVEQLSNMVVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 47/270 (17%)
TGF_beta 481..585 CDD:278448 39/105 (37%)
TGFB3NP_001316868.1 TGFb_propeptide 24..230 CDD:395559 44/224 (20%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 40/107 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.