DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and TGFB1

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_011525544.1 Gene:TGFB1 / 7040 HGNCID:11766 Length:391 Species:Homo sapiens


Alignment Length:401 Identity:98/401 - (24%)
Similarity:168/401 - (41%) Gaps:79/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 AGGCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDD 291
            |.|...|::      |..|.:...|||.::.|||.||||...|....|. |.|:.:.:...:  :
Human    27 AAGLSTCKT------IDMELVKRKRIEAIRGQILSKLRLASPPSQGEVP-PGPLPEAVLALY--N 82

  Fly   292 STKNKELD-----------DYYARTSKKFILLNREEVECNRARDGKSNPSMCF-TFKIDDADAEG 344
            ||:::...           ||||:...:.:::.......::.:....:..|.| |.::.:|..|.
Human    83 STRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEP 147

  Fly   345 FDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQKDS---KYLSAAKTIAIQSVNVQ 406
            ..:|.|.|.|.:.|..                |...||:.|:..:   :|||.    .:.:.:..
Human   148 VLLSRAELRLLRLKLK----------------VEQHVELYQKYSNNSWRYLSN----RLLAPSDS 192

  Fly   407 DEWMKIDIEWPIKHWIS-GHELSHL-IQITCGGCDVSDMEEIISVDKDY---------------R 454
            .||:..|:...::.|:| |.|:... :...| .||..|....:.::..:               |
Human   193 PEWLSFDVTGVVRQWLSRGGEIEGFRLSAHC-SCDSRDNTLQVDINAGFTTGRRGDLATIHGMNR 256

  Fly   455 PFIV-----IDMQNRRRKSRQKRSIN---C-SSGMTECCREHLYISFR-DIGWSNWILKPEGYNA 509
            ||::     ::.....:.||.:|:::   | ||....||...|||.|| |:|| .||.:|:||:|
Human   257 PFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGW-KWIHEPKGYHA 320

  Fly   510 YFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKT 574
            .||.|.|..:.|:.   :.:|.::.:.:..  |......|||..:....|.:|.. ......|:.
Human   321 NFCLGPCPYIWSLD---TQYSKVLALYNQH--NPGASAAPCCVPQALEPLPIVYY-VGRKPKVEQ 379

  Fly   575 LPNMVVESCGC 585
            |.||:|.||.|
Human   380 LSNMIVRSCKC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 52/245 (21%)
TGF_beta 481..585 CDD:278448 35/104 (34%)
TGFB1XP_011525544.1 TGFb_propeptide 30..262 CDD:395559 54/261 (21%)
TGF_beta_TGFB1 293..391 CDD:381654 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.