DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp8b

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002729572.1 Gene:Bmp8b / 679119 RGDID:1591873 Length:399 Species:Rattus norvegicus


Alignment Length:255 Identity:60/255 - (23%)
Similarity:117/255 - (45%) Gaps:57/255 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 TIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQDE-WMKIDIEWPIKHWISGH--ELSHLIQITCG 436
            |:.:|..||.|::.::. |....:.:|::...|| |:.:||......|:..|  :|...:.:   
  Rat   157 TLHISMFEVVQERSNRE-SDLFFLDLQTLRSGDEGWLVLDITAASDRWLLNHNKDLGLRLYV--- 217

  Fly   437 GCDVSDMEEIISVD------------KDYRPFIVIDMQ--------NRRRKSRQKRSINCSSGM- 480
                 :.|:..|:|            :..:||:|...:        .|..:..:|:.:|..:.: 
  Rat   218 -----ETEDGHSLDPGLAGLLGQTAPRSRQPFMVGFFKASQSPVRAPRTARPLKKKKLNQVNQLP 277

  Fly   481 -----------------TECCREH-LYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAAS 527
                             .|.||.| ||:||||:||.:.::.|:||:||:|.|.|....:....::
  Rat   278 NSNKHLGIFDDGHGSLDREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNST 342

  Fly   528 HHSSIMKILSTSGANKSLELVP--CCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            :|:::..::..    ...::||  ||...:.|::.|:..|.:|...::...||||::|||
  Rat   343 NHATMQALVHL----MKPDIVPKVCCVPTKLSAISLLYYDRNNNVILRRERNMVVQACGC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 20/97 (21%)
TGF_beta 481..585 CDD:278448 34/106 (32%)
Bmp8bXP_002729572.1 TGFb_propeptide 32..248 CDD:279078 21/99 (21%)
TGF_beta 298..398 CDD:278448 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.