DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and BMP5

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_066551.1 Gene:BMP5 / 653 HGNCID:1072 Length:454 Species:Homo sapiens


Alignment Length:443 Identity:98/443 - (22%)
Similarity:169/443 - (38%) Gaps:141/443 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 HLRIEFVKQQILEKLRLKESPK--------VSAVELPKPIFDGMTLSHPDDSTKNKELDDYYART 305
            |.|.| ::::||..|.|...|:        .||......:::.||      :.:|.|..:|..|.
Human    46 HERRE-IQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMT------NEENPEESEYSVRA 103

  Fly   306 SKKFILLNREEVECNRARDG----------------------KSNP--SMCFTFKIDDAD----- 341
            |.        ..|...||.|                      :|.|  |:..|..::|||     
Human   104 SL--------AEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSF 160

  Fly   342 ---------------------------AEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVS 379
                                       ..|..|:.|...::|::.        |:....:||.:|
Human   161 VNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRS--------NNRFENETIKIS 217

  Fly   380 EVEVDQQ---KDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVS 441
            ..::.::   :|:. |....|...|:::|  .|:..||.....||:...:.:..:|:    |..:
Human   218 IYQIIKEYTNRDAD-LFLLDTRKAQALDV--GWLVFDITVTSNHWVINPQNNLGLQL----CAET 275

  Fly   442 DMEEIISV----------DKDYRPFIVI------------------DMQNRRRKSRQKRSINCS- 477
            .....|:|          .:..:||:|.                  ..|||.:.|..:.|...| 
Human   276 GDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSS 340

  Fly   478 ------SGMTECCREH-LYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHS---SI 532
                  |...:.|::| ||:||||:||.:||:.||||.|::|.|.||...:....|::|:   ::
Human   341 VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTL 405

  Fly   533 MKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            :.::......|     |||...:.:::.::..|.|:...:|...||||.||||
Human   406 VHLMFPDHVPK-----PCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGC 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 52/285 (18%)
TGF_beta 481..585 CDD:278448 36/107 (34%)
BMP5NP_066551.1 TGFb_propeptide 32..304 CDD:395559 53/287 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..343 6/24 (25%)
TGF_beta_BMP5 342..454 CDD:381665 39/117 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.