DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and BMP4

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001334841.1 Gene:BMP4 / 652 HGNCID:1071 Length:455 Species:Homo sapiens


Alignment Length:423 Identity:90/423 - (21%)
Similarity:161/423 - (38%) Gaps:82/423 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PETPIEPELPLGERNITISVKSSAGGCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKES 268
            |||        |::.:. .::..|||   ..|.:..|.:.:.:.|.|:        :..||.:..
Human    75 PET--------GKKKVA-EIQGHAGG---RRSGQSHELLRDFEATLLQ--------MFGLRRRPQ 119

  Fly   269 PKVSAVELPKPIFDGMTLSHPDDSTKN--------KELDDYYARTSKKFILLNREEVECNRARDG 325
            |..||| :|..:.|...|...::..:.        .|.....|.|.:.|    ..|.........
Human   120 PSKSAV-IPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF----HHEEHLENIPGT 179

  Fly   326 KSNPSMCFTFKIDDADAEGFDVSTAVLWLFKNKQ----------NRTDTASVNSTSAQQTIVVSE 380
            ..|.:..|.|.:... .|...:|:|.|.||:.:.          :|.:...|....|:   ||..
Human   180 SENSAFRFLFNLSSI-PENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAE---VVPG 240

  Fly   381 VEVDQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWIS--------GHELSHLIQI-TCG 436
            ..:.:..|::.:....|          .|...|:...:..|..        ..|::||.|. |..
Human   241 HLITRLLDTRLVHHNVT----------RWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQ 295

  Fly   437 GCDVSDMEEIISVDKDY---RPFIV----------IDMQNRRRKSRQKRSINCSSGMTECCREHL 488
            |..|.....:.....::   ||.:|          :..:.|.::|.:..|.........|.|..|
Human   296 GQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSL 360

  Fly   489 YISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTA 553
            |:.|.|:||::||:.|.||.|::|.|.|....:....:::|:.:..::::  .|.|:... ||..
Human   361 YVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNS--VNSSIPKA-CCVP 422

  Fly   554 KQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586
            .:.|::.::.:|..:...:|....||||.||||
Human   423 TELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 44/243 (18%)
TGF_beta 481..585 CDD:278448 30/103 (29%)
BMP4NP_001334841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.