DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp15

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_067702.1 Gene:Bmp15 / 59302 RGDID:70990 Length:391 Species:Rattus norvegicus


Alignment Length:193 Identity:41/193 - (21%)
Similarity:90/193 - (46%) Gaps:34/193 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 IDIEWPIKHWISGHELSHLIQITCGGCDVSDMEEIIS------VDKDYRPFIVIDMQNRRR---- 466
            :::.|   |.::..:::.|: :.....|.|...::::      .|:: .||:   |::.|:    
  Rat   215 LELRW---HGMTSLDVAFLL-LYFDDTDESAQAKLLARGQEELTDRE-SPFL---MRSVRQTCSI 271

  Fly   467 -------KSRQKRSINCSSGMTECCREHLY-ISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVT 523
                   ...|.||:|      ..|..|.| :||..:||.:||:.|..|...:|:|.|:.|....
  Rat   272 ASDVPCPSQEQDRSVN------NQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTGVLPYG 330

  Fly   524 QAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586
            ..:.:|:.|..:::.. .|:|:..:.|...| :..:.:::::::.:...|....|:.:||.||
  Rat   331 LNSPNHAIIQSLVNEL-VNRSVPQLSCVPYK-FLPMSILLIEANGSILYKEYEGMIAQSCTCR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 8/51 (16%)
TGF_beta 481..585 CDD:278448 25/104 (24%)
Bmp15NP_067702.1 TGF_beta 288..390 CDD:278448 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.