DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and tgfb1b

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_692338.3 Gene:tgfb1b / 563884 ZFINID:ZDB-GENE-091028-1 Length:379 Species:Danio rerio


Alignment Length:396 Identity:92/396 - (23%)
Similarity:151/396 - (38%) Gaps:104/396 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDSTKNKEL----------- 298
            |.:...|||.::.|||.||||.:.|:|...||.:.|...:...:......|:|.           
Zfish    32 ELIKRKRIEAIRGQILSKLRLPKEPEVEEKELIENIPAELISVYNSTMELNEEQAANPVQHTIED 96

  Fly   299 ---DDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFKNK-- 358
               ::|||:...||.::             :..|.....|.|.|               .|:|  
Zfish    97 PTEEEYYAKEIHKFTMM-------------EEKPEKYLVFNITD---------------IKHKLG 133

  Fly   359 --------QNRTDTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIE 415
                    :.|..........::|.:.:.:|..::   |:||: ::.|::|:..   :|:..|:.
Zfish   134 ANHVLYQAEFRLRIKEPKMGDSEQRLELYQVTGNK---SRYLN-SRFISLQTAG---KWVSFDVT 191

  Fly   416 WPIKHWISGHE--LSHLIQITCGGCDVSDMEEI---------------ISVDKDYRPFIVIDMQ- 462
            ..:|.|:...|  ....:|:.|.....|...|.               :..|:..:|:|::... 
Zfish   192 STLKDWLQMPEEKQEFQLQLACSCKPESQNTEFLFKIAGLSRNRGDTGLLADQVAKPYILVMSHP 256

  Fly   463 ---NRRRKSRQKRSIN--CSSGMTECCREHLYISFR-DIGWSNWILKPEGYNAYFCRGSCSSV-- 519
               :...|||:||..:  |:.....||...|||.|| |:|| .||.:|.||.|.:|.||||.|  
Zfish   257 ADGHSPAKSRRKRETDAVCTEKSEGCCVRSLYIDFRKDLGW-KWIHEPSGYYANYCTGSCSYVWT 320

  Fly   520 -----ASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMV 579
                 :.|.....||            |......|||..:....|.::.. ......|:.|.||:
Zfish   321 SENKYSQVLALYRHH------------NPGASAQPCCVPQVLDPLPIIYY-VGRQHKVEQLSNMI 372

  Fly   580 VESCGC 585
            |::|.|
Zfish   373 VKTCKC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 48/253 (19%)
TGF_beta 481..585 CDD:278448 36/111 (32%)
tgfb1bXP_692338.3 TGFb_propeptide 22..253 CDD:279078 49/255 (19%)
TGF_beta 280..378 CDD:278448 36/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12159
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.