DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and bmp6

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001013357.1 Gene:bmp6 / 503761 ZFINID:ZDB-GENE-050306-42 Length:417 Species:Danio rerio


Alignment Length:456 Identity:96/456 - (21%)
Similarity:175/456 - (38%) Gaps:117/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 DFVRNELMAEDQQNQEKDLDLDLDLDQQPETPIEPELPLGERN----ITISVKSSAGGCPKCESN 236
            :|:...|.:::::..:|::...|.|:.:|    .|.|..|:.|    ..:.:.:|..        
Zfish    32 NFIHRRLRSQEKREMQKEILSILGLNHRP----RPHLNSGKYNSAPLFMLDLYNSMS-------- 84

  Fly   237 RQVEHITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDSTKNKELDDY 301
                  |||:                         |.|:..:.:|   |.:.|..::.:.....:
Zfish    85 ------TEEK-------------------------SDVDQYRSLF---TTTRPALASHHDTEFLH 115

  Fly   302 YARTSKKFILL--NREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFKNKQNRTDT 364
            .|.....|:.|  |..|:...| |..|.     |.|.:... .||..::.|...::|.       
Zfish   116 DADMVMSFVNLVENDRELSLQR-RHHKE-----FKFNLSQI-PEGEAITAAEFRIYKE------- 166

  Fly   365 ASVNSTSAQQTIVVSEVEV-----DQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISG 424
             .|.|....:|.::|..:|     |:..|...|.:.:.     ...:..|::.||......|:..
Zfish   167 -CVTSAFRNETFLLSVFQVVGEHPDRDADLFLLESRRL-----WGAEQGWLEFDITATSNLWVMS 225

  Fly   425 --HELSHLIQI-TCGGCDVSDMEE-IISVD--KDYRPFIV---------------IDMQNRRRKS 468
              |.|...|.: |..|..:|..:. ::..|  .:.:||:|               ...|.:|.::
Zfish   226 PHHNLGLQISVETSSGRSISPKDAGLVGRDGALERQPFMVAFFKVSEVRIRTSRSTGKQRQRNRN 290

  Fly   469 RQKRSINCSSG----------MTECCREH-LYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASV 522
            |.......|.|          ....||:| ||:|||::.|.:||:.||||.|.:|.|.||...:.
Zfish   291 RSNSPQEASKGPAHTDYNSSDQKTACRKHDLYVSFRELSWQDWIIAPEGYAANYCDGECSFPLNA 355

  Fly   523 TQAASHHS---SIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCG 584
            ...|::|:   :::.:::.....|     |||...:..::.::..|.::...:|...||||.|||
Zfish   356 HMNATNHAIVQTLVHLMNPENVPK-----PCCAPTKLHAISVLYYDDNSNVILKKYRNMVVRSCG 415

  Fly   585 C 585
            |
Zfish   416 C 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 42/226 (19%)
TGF_beta 481..585 CDD:278448 34/107 (32%)
bmp6NP_001013357.1 TGFb_propeptide 28..267 CDD:279078 55/300 (18%)
TGFB 316..417 CDD:214556 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.