DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001103141.1 Gene:Gdf3 / 500311 RGDID:1564178 Length:366 Species:Rattus norvegicus


Alignment Length:242 Identity:46/242 - (19%)
Similarity:100/242 - (41%) Gaps:62/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 YLSAAKTIAIQSVNVQDEW----------------------MKIDIEWPIKHWISGHELSHLIQI 433
            ||.....:|:..|..:..|                      ::.:::..:|.| :.|:|.:|   
  Rat   139 YLQLELVVAVSVVQDRGVWGRSHPKLGRLLVQKSVLGPQGSLQFNLQGVVKDW-NRHQLKNL--- 199

  Fly   434 TCGGCDVSDMEEIISVDKDYRP--------------------FIVIDMQNRRRKSRQKR-SINCS 477
                 |:. :|.::..|:..|.                    .:.:::::....||:|| :|...
  Rat   200 -----DLY-LEILVKEDRYSRVNAQLDNPCNQLMHSLHASLLVVTLNLKHCHPSSRKKRAAIPIP 258

  Fly   478 SGMTE--CCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSG 540
            .|:..  |.|..|:::|:|:||..|::.|:|:.|.:|.|.|....:....:|:::.:..::..:.
  Rat   259 KGLCRNLCHRHQLFVNFQDLGWHKWVIAPKGFMANYCHGDCPFTMTTYLNSSNYAFMQALMHMAD 323

  Fly   541 ANKSLELVP--CCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            ..     ||  .|...:.|.:.::..|:.....::...:|||:.|||
  Rat   324 PR-----VPKAVCIPTKLSPISMLYQDNEKNVILRHYEDMVVDECGC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 14/108 (13%)
TGF_beta 481..585 CDD:278448 24/107 (22%)
Gdf3NP_001103141.1 TGFB 266..366 CDD:214556 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.