DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp10

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001026994.1 Gene:Bmp10 / 500245 RGDID:1562986 Length:421 Species:Rattus norvegicus


Alignment Length:411 Identity:83/411 - (20%)
Similarity:138/411 - (33%) Gaps:120/411 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 IEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREE 316
            ::.:|.:.|:.|.|.:.|                   |.| |...:..:|......||       
  Rat    55 LQSMKDEFLKTLNLSDIP-------------------PQD-TGRVDPPEYMLELYNKF------- 92

  Fly   317 VECNRARDGKSNPS--MCFTFKIDDADAEG------------FDVS--------TAVLWLFKNKQ 359
                 |.|..|.||  :..:||.:|..::.            |:||        .|.|.|:...|
  Rat    93 -----ATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEVVMAELRLYTLVQ 152

  Fly   360 NRTDTASVNSTSAQQTIVVSEV--EVDQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWI 422
            .  |....:  ...:.|::.||  ..|..:|.:.:....:..|...|  .||...||....:.|.
  Rat   153 R--DRLMYD--GVDRKIIIFEVLESADGSEDERSMLVLVSTEIYGTN--SEWETFDITDATRRWQ 211

  Fly   423 SGHELSHLIQI-----------TCGGCDVSDMEEIISVDKDYRPFIVIDMQNRRRKSRQKRSIN- 475
            .....:|.::|           |..|    .:|..:|....:.|.:|:...::.....||..:| 
  Rat   212 KSGPSTHQLEIHIESRQNQAEDTGRG----QLEIDMSAQNKHDPLLVVFSDDQSGDKEQKEELNE 272

  Fly   476 --------------------------CSSGMTE--------------CCREHLYISFRDIGWSNW 500
                                      ..|.|.:              |.:..|||.|::|||.:|
  Rat   273 LISHEQDLDLGTDGFFGGPDEEALLQMRSNMIDDSTARIRRNAKGNYCKKTPLYIDFKEIGWDSW 337

  Fly   501 ILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMD 565
            |:.|.||.||.|||.|:...:.....:.|:.|..::....:.|:.:  .||...:...:.::.:|
  Rat   338 IIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASK--ACCVPTKLDPISILYLD 400

  Fly   566 SSNTATVKTLPNMVVESCGCR 586
            ............|.|..||||
  Rat   401 KGVVTYKFKYEGMAVSECGCR 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 46/240 (19%)
TGF_beta 481..585 CDD:278448 28/117 (24%)
Bmp10NP_001026994.1 TGFb_propeptide 55..256 CDD:279078 47/242 (19%)
TGF_beta 318..420 CDD:278448 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.