DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Lefty1

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001102550.1 Gene:Lefty1 / 498299 RGDID:1561867 Length:368 Species:Rattus norvegicus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:140/405 - (34%) Gaps:128/405 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 EHITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMT------------LSHPDDS 292
            |.:|.||        |...:|::|||...|     .|.|...:||.            |.|..||
  Rat    20 EALTGEQ--------VLGSLLQQLRLDRPP-----VLDKADVEGMVIPSHVRAQYVALLQHSHDS 71

  Fly   293 -TKNKELDDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFK 356
             ::.|.....:...:.:|::              ....|....|.::.......::..|||.||:
  Rat    72 RSRGKRFSQNFREVAGRFLV--------------SETSSHLLVFGMEQRLPPNSELVQAVLRLFQ 122

  Fly   357 NKQNRT-----DTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQS--VNVQDE-WMKID 413
            ....||     ...|.:|..|:.||.......|        .:.:|..|.|  |::.:. |...|
  Rat   123 EPVPRTALRRQKRLSPHSARARVTIEWLRFRED--------GSNRTALIDSRLVSIHESGWKVFD 179

  Fly   414 IEWPIKHW-------------------------ISGHELSHL-IQITCGGCDVSDME-EIISVD- 450
            :...:..|                         .|.|:|... .|.|..|..:.:.: |:.::| 
  Rat   180 VTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGLGEPQLELHTLDL 244

  Fly   451 KDYRPFIVIDMQNRRRKSRQKRSINC------SSGMTECCREHLYISFRDIGWS-NWILKPEGYN 508
            |||      ..|.           ||      :.| |.|||:.:|:..:.:.|: ||||:|.|:.
  Rat   245 KDY------GAQG-----------NCDPETPVTEG-TRCCRQEMYLDLQGMKWAENWILEPPGFL 291

  Fly   509 AYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVM---DSSNTA 570
            .|.|.|||         .....|:.......|..:       |.|.:.:||.|:|.   |.....
  Rat   292 TYECVGSC---------LQPPESLTIRWPFLGPRQ-------CVASEMTSLPLIVSIKEDGRTRP 340

  Fly   571 TVKTLPNMVVESCGC 585
            .|.:||||.|:.|.|
  Rat   341 QVVSLPNMRVQRCSC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 51/262 (19%)
TGF_beta 481..585 CDD:278448 33/107 (31%)
Lefty1NP_001102550.1 TGFb_propeptide 29..211 CDD:413528 37/208 (18%)
TGF_beta_LEFTY1_2 264..355 CDD:381636 32/106 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.