Sequence 1: | NP_001259967.1 | Gene: | daw / 33474 | FlyBaseID: | FBgn0031461 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012383.1 | Gene: | gdf9 / 497643 | ZFINID: | ZDB-GENE-050221-7 | Length: | 418 | Species: | Danio rerio |
Alignment Length: | 315 | Identity: | 61/315 - (19%) |
---|---|---|---|
Similarity: | 123/315 - (39%) | Gaps: | 97/315 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 358 KQNR----TDTA-SVNSTSAQQTIVVS------------------EVEVDQQKDSK------YLS 393
Fly 394 AAKTIAIQSVNVQDEWMKIDIEWPIKHWISGH--ELSHLIQITCGGCDVSDMEEIIS-------- 448
Fly 449 --VDKDYR-PFIVIDMQNR-----RRKSRQKRSINCSSG-------------------------- 479
Fly 480 ----------MTECCREHLY---ISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSS 531
Fly 532 IMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
daw | NP_001259967.1 | TGFb_propeptide | 244..458 | CDD:279078 | 30/141 (21%) |
TGF_beta | 481..585 | CDD:278448 | 24/106 (23%) | ||
gdf9 | NP_001012383.1 | TGF_beta | 317..417 | CDD:278448 | 23/103 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3900 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |