DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and scw

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:424 Identity:77/424 - (18%)
Similarity:156/424 - (36%) Gaps:94/424 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ETPIEPELPLGERNITISVKSSAGGCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKESP 269
            |.||..:.||.|:...|.: ...|..|:    ||.|.......:...:|...:            
  Fly    27 EMPIYQKRPLSEQMEMIDI-LDLGDRPR----RQAEPNLHNSASKFLLEVYNE------------ 74

  Fly   270 KVSAVELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREE----VECN---------R 321
             :|..:.||.:.         .....:.|||        .||::.|:    ..||         :
  Fly    75 -ISEDQEPKEVL---------HQRHKRSLDD--------DILISNEDRQEIASCNSILTFSSRLK 121

  Fly   322 ARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQ 386
            .....:...|..||..:|...: ..:..|:|.::|.       .|:....|..|:.|.. ::|.:
  Fly   122 PEQLDNELDMHITFNTNDVPVD-LSLVQAMLRIYKQ-------PSLVDRRANFTVSVYR-KLDNR 177

  Fly   387 KDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWI--SGHELSHLIQITCGGCDVSDMEEIISV 449
            :|..|....   ::.:.:.|..|::.::...:::|:  .|.:..:.::|:.|...:|.....:..
  Fly   178 QDFSYRILG---SVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVT 239

  Fly   450 DKDYR----PFIV---------IDMQNRR-RKSRQKR-------------SINCSSGMTECCREH 487
            .:..|    ||||         :.:|..| ::..:||             .::.......|.|.:
  Fly   240 PQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLN 304

  Fly   488 LYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLEL-VPCC 551
            ..:.|:::...||::.|:.:.||||.|.|:........|::|:.:..::..    |...| .|||
  Fly   305 FTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHL----KQPHLPKPCC 365

  Fly   552 TAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            ......::.::...:.:...:......|.:.|||
  Fly   366 VPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 36/232 (16%)
TGF_beta 481..585 CDD:278448 21/104 (20%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 44/261 (17%)
TGFB 300..400 CDD:214556 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.