DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and INHA

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_002182.1 Gene:INHA / 3623 HGNCID:6065 Length:366 Species:Homo sapiens


Alignment Length:282 Identity:62/282 - (21%)
Similarity:98/282 - (34%) Gaps:85/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 VSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQDEWMK 411
            |::|.|| |....:|..||:.||:.....::.             ||....:|:.        |.
Human   126 VTSAQLW-FHTGLDRQGTAASNSSEPLLGLLA-------------LSPGGPVAVP--------MS 168

  Fly   412 IDIEWPIKHWISGH-------ELSH---LIQITCGGCDVSDMEEIISVDKDYRPFIVIDMQNRRR 466
            :....|  ||...|       .|:|   ::.:.|..|..|...|.       .||:|...:.|..
Human   169 LGHAPP--HWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEA-------TPFLVAHTRTRPP 224

  Fly   467 K--SRQKRSINCSS-------------------GMTECCREHLYISFRDIGWSNWILKPEGYNAY 510
            .  .|.:||....|                   ....|.|..|.|||:::||..||:.|..:..:
Human   225 SGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFH 289

  Fly   511 FCRGSCS---------SVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDS 566
            :|.|.|.         .|.......:...|::     .||.      |||.|...:...|.|..:
Human   290 YCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLL-----PGAQ------PCCAALPGTMRPLHVRTT 343

  Fly   567 SN---TATVKTLPNMVVESCGC 585
            |:   :...:|:||::.:.|.|
Human   344 SDGGYSFKYETVPNLLTQHCAC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 26/120 (22%)
TGF_beta 481..585 CDD:278448 29/115 (25%)
INHANP_002182.1 TGFB 262..366 CDD:214556 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.