DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and BMP8A

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_861525.2 Gene:BMP8A / 353500 HGNCID:21650 Length:402 Species:Homo sapiens


Alignment Length:438 Identity:105/438 - (23%)
Similarity:174/438 - (39%) Gaps:108/438 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PLGERNITISVKSSAG-------GCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKESPK 270
            ||....:|:......|       |||            :.:|.......|:::||..|.|...|:
Human     7 PLWLLGLTLCALGGGGPGLRPPPGCP------------QRRLGARERRDVQREILAVLGLPGRPR 59

  Fly   271 ----VSAVELP--KPIFDGMTLSHP---DDSTKNKELDDYYARTSKKFILLNREEVECNRARDGK 326
                .:|..||  .|:| .:.|.|.   ||.......:....|.......:|.  ||.:||. |.
Human    60 PRAPPAASRLPASAPLF-MLDLYHAMAGDDDEDGAPAEQRLGRADLVMSFVNM--VERDRAL-GH 120

  Fly   327 SNPSMC-FTFKIDDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQKDSK 390
            ..|... |.|.:....| |..|:.|...::|       ..|::..:  :|:.||..:|.|::.::
Human   121 QEPHWKEFRFDLTQIPA-GEAVTAAEFRIYK-------VPSIHLLN--RTLHVSMFQVVQEQSNR 175

  Fly   391 YLSAAKTIAIQSVNVQDE-WMKIDIE-----WPIK-HWISGHELSHLIQITCGGCDVSDMEEIIS 448
            . |....:.:|::...|| |:.:|:.     |.:| |...|..|            ..:.|:..|
Human   176 E-SDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRL------------YVETEDGHS 227

  Fly   449 VD------------KDYRPFIVIDMQN--------------RRRKSRQKR-------------SI 474
            ||            :..:||:|...:.              |||:.::..             .:
Human   228 VDPGLAGLLGQRAPRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDV 292

  Fly   475 NCSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTS 539
            ..|.|...|.|..||:||:|:||.:|::.|:||:||:|.|.||........|::|:.:..::...
Human   293 RGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLM 357

  Fly   540 GANKSLELVP--CCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            ..|    .||  ||...:.|:..::..||||...::...||||::|||
Human   358 KPN----AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGC 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 54/242 (22%)
TGF_beta 481..585 CDD:278448 36/105 (34%)
BMP8ANP_861525.2 TGFb_propeptide 33..251 CDD:279078 55/244 (23%)
TGF_beta 299..401 CDD:278448 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.