DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf15

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_062089.1 Gene:Gdf15 / 29455 RGDID:2674 Length:303 Species:Rattus norvegicus


Alignment Length:134 Identity:34/134 - (25%)
Similarity:58/134 - (43%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 IDMQNRRRKSRQKRSI------NCSSGMTECCR-EHLYISFRDIGWSNWILKPEGYNAYFCRGSC 516
            :::..|....|.:||.      :|..|...||. |.:..:..|:|||:|:|.|.......|.|.|
  Rat   175 LELHLRSAAGRGRRSAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGEC 239

  Fly   517 SSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVE 581
               ..:.::|:.|:.|...|  .|........|||....|:.:.|:....|. .:::|..::|.:
  Rat   240 ---PHLYRSANTHALIKARL--HGLQPDRVPAPCCVPSSYTPVVLMHRTDSG-VSLQTYDDLVAQ 298

  Fly   582 SCGC 585
            .|.|
  Rat   299 GCHC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078
TGF_beta 481..585 CDD:278448 27/104 (26%)
Gdf15NP_062089.1 TGF_beta 204..302 CDD:278448 27/103 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.