DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf11

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_058899.1 Gene:Gdf11 / 29454 RGDID:2673 Length:405 Species:Rattus norvegicus


Alignment Length:417 Identity:103/417 - (24%)
Similarity:164/417 - (39%) Gaps:101/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GERNI--TISVKSSAGGCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKESPKVS--AVE 275
            |||:.  ..|......|||.|        :..:....||:|.:|.|||.||||||:|.:|  .|:
  Rat    43 GERSSRPAPSAAPEPDGCPVC--------VWRQHSRELRLESIKSQILSKLRLKEAPNISREVVK 99

  Fly   276 --LPK--PI--------FDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREEVECNRARDGKS- 327
              |||  |:        |.|..| .|:|..   |.|:|:|.|  :.::...:|.:.....||.. 
  Rat   100 QLLPKAPPLQQILDLHDFQGDAL-QPEDFL---EEDEYHATT--ETVISMAQETDPAVQTDGSPL 158

  Fly   328 ------NPSMCFTFKIDDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQ 386
                  :|.:.||           .|..|.||::.....|..|..:                 |.
  Rat   159 CCHFHFSPKVMFT-----------KVLKAQLWVYLRPVPRPATVYL-----------------QI 195

  Fly   387 KDSKYLSAAKT----------IAIQSVNVQ-----DEWMKIDIEWPIKHWISGHELSHLIQITC- 435
            ...|.|:...|          |.|:|:.::     ..|..||.:..:..|....:.:..|:|.. 
  Rat   196 LRLKPLTGEGTAGGGGGGRRHIRIRSLKIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINAF 260

  Fly   436 --GGCDVSDMEEIISVD---KDYRPFIVIDMQNRRRKSRQKRSINCS--SGMTECCREHLYISFR 493
              .|.|::    :.|:.   :...||:.:.:....::||:...::|.  |..:.|||..|.:.|.
  Rat   261 DPSGTDLA----VTSLGPGAEGLHPFMELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFE 321

  Fly   494 DIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSS 558
            ..|| :||:.|:.|.|.:|.|.|..:  ..|...|...:.:      ||......||||..:.|.
  Rat   322 AFGW-DWIIAPKRYKANYCSGQCEYM--FMQKYPHTHLVQQ------ANPRGSAGPCCTPTKMSP 377

  Fly   559 LQLVVMDSSNTATVKTLPNMVVESCGC 585
            :.::..:.........:|.|||:.|||
  Rat   378 INMLYFNDKQQIIYGKIPGMVVDRCGC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 60/255 (24%)
TGF_beta 481..585 CDD:278448 29/103 (28%)
Gdf11NP_058899.1 TGFb_propeptide 59..283 CDD:307025 63/269 (23%)
TGFB 311..405 CDD:214556 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11684
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.