DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Mstn

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_062024.1 Gene:Mstn / 29152 RGDID:3115 Length:376 Species:Rattus norvegicus


Alignment Length:411 Identity:101/411 - (24%)
Similarity:171/411 - (41%) Gaps:78/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LDLDLDQQPETPIEPELPLGERNITISVKSSAGGCPKCESNRQVEHITEEQLTHLRIEFVKQQIL 260
            :||:.|.:.|..:|.|                |.|..|        ...:...:.|||.:|.|||
  Rat    22 VDLNEDSEREANVEKE----------------GLCNAC--------AWRQNTRYSRIEAIKIQIL 62

  Fly   261 EKLRLKESPKVS--AVE--LP-----KPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREE 316
            .||||:.:|.:|  |:.  ||     :.:.|...:...|.|..:.|.|||:|.|  :.|:....|
  Rat    63 SKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATT--ETIITMPTE 125

  Fly   317 VECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEV 381
            .:.....|||  |..|| ||. .:..:...|..|.||::           :.:.....|:.|..:
  Rat   126 SDFLMQADGK--PKCCF-FKF-SSKIQYNKVVKAQLWIY-----------LRAVKTPTTVFVQIL 175

  Fly   382 E-VDQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEE 445
            . :...||....:..:::.:........|..||::..:::|:...| |:|      |.::..::|
  Rat   176 RLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPE-SNL------GIEIKALDE 233

  Fly   446 ---IISV------DKDYRPFIVIDMQNRRRKSRQKRSINCSSGMTE--CCREHLYISFRDIGWSN 499
               .::|      :....||:.:.:.:..::||:...::|....||  |||..|.:.|...|| :
  Rat   234 NGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGW-D 297

  Fly   500 WILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVM 564
            ||:.|:.|.|.:|.|.|..|  ..|...|...:.:      ||......||||..:.|.:.::..
  Rat   298 WIIAPKRYKANYCSGECEFV--FLQKYPHTHLVHQ------ANPRGSAGPCCTPTKMSPINMLYF 354

  Fly   565 DSSNTATVKTLPNMVVESCGC 585
            :.........:|.|||:.|||
  Rat   355 NGKEQIIYGKIPAMVVDRCGC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 55/232 (24%)
TGF_beta 481..585 CDD:278448 32/105 (30%)
MstnNP_062024.1 TGFb_propeptide 37..250 CDD:413528 57/260 (22%)
TGF_beta_GDF8 269..376 CDD:381658 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11684
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.