DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Lefty2

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001007557.1 Gene:Lefty2 / 289316 RGDID:1359679 Length:366 Species:Rattus norvegicus


Alignment Length:409 Identity:86/409 - (21%)
Similarity:146/409 - (35%) Gaps:142/409 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ITEEQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTL--------------SHPDDS 292
            :||||        |...:|::|:|.::|.:..|::     :||.:              ||.|.|
  Rat    22 VTEEQ--------VLSSLLKQLQLSQAPVLDRVDV-----EGMAIPTHVSSQYVALLQGSHADRS 73

  Fly   293 TKNKELDDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFKN 357
             :.|.....:...:.:|::              ....|....|.::.......::..|:|.||:.
  Rat    74 -RGKRFSQNFREVAGRFLV--------------SETSSHLLVFGMEQRLPPNSELVQAMLRLFQE 123

  Fly   358 KQNRTDTASVNST---SAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQS--VNVQDE-WMKIDIEW 416
            ...||....:...   |||..:.:..:.|.:.      .:.:|..|.|  |::.:. |...|:..
  Rat   124 PVPRTALRRLERLPPHSAQARVTIEWLRVRED------GSNRTALIDSRLVSIYESGWKVFDVTE 182

  Fly   417 PIKHW-------------------------ISGHELSHLIQITCGGCDVSDME---EIISVD-KD 452
            .:..|                         .|.|:   |::....|......|   |:.::| ||
  Rat   183 AVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHK---LVRFAAQGTPDGKGEPQLELHTLDLKD 244

  Fly   453 YRPFIVIDMQNRRRKSRQKRSINC------SSGMTECCREHLYISFRDIGWS-NWILKPEGYNAY 510
            |      ..|.           ||      :.| |.|||:.:|:..:.:.|: ||||:|.|:..|
  Rat   245 Y------GAQG-----------NCDPEAPVTEG-TRCCRKEMYLDLQGMKWAENWILEPPGFLIY 291

  Fly   511 FCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLE-----LVP-CCTAKQYSSLQLVVM---DS 566
            .|.|||..:.                      :||.     |.| .|.|.:.:||.::|.   |.
  Rat   292 ECVGSCRQLP----------------------ESLTIGWPFLGPRQCVASEMTSLPMIVSIKEDG 334

  Fly   567 SNTATVKTLPNMVVESCGC 585
            .....|.:||||.|::|.|
  Rat   335 KTRPQVVSLPNMRVQTCSC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 46/262 (18%)
TGF_beta 481..585 CDD:278448 34/113 (30%)
Lefty2NP_001007557.1 TGF-beta propeptide 45..231 32/214 (15%)
TGFb_propeptide <68..211 CDD:279078 25/163 (15%)
TGF_beta 261..353 CDD:278448 34/113 (30%)
transforming growth factor beta-like domain 263..353 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.