DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and tig-3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_497318.2 Gene:tig-3 / 266879 WormBaseID:WBGene00021594 Length:251 Species:Caenorhabditis elegans


Alignment Length:310 Identity:63/310 - (20%)
Similarity:110/310 - (35%) Gaps:77/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 STKNKELDDYYARTSKKFIL-LNREEVEC----NRARDGKSNPSMCFTFKIDDADAEGFDVSTAV 351
            ||..|.  |.|.....|..| .||:...|    :..:|       ||.:.|:..:.|....|..:
 Worm     2 STSRKH--DLYGGVLDKITLEPNRKSWTCLTPESLVKD-------CFQYSINSINHEILSASLII 57

  Fly   352 LWLFKNKQNRTDTASVNSTSAQQTIVVSEVE--------VDQQKDSKYLSAAKTIAIQSVNVQDE 408
                       |....|.     :|||.||:        ||:.:..:.|              |:
 Worm    58 -----------DPKDTNI-----SIVVYEVDELFGELQYVDRFEIRETL--------------DK 92

  Fly   409 WMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEEIISVDKDYRPFIVIDMQNRRRKSRQKRS 473
            : ..||......|:.......:|:|.....:..::...:||.::...|.|:..|..         
 Worm    93 Y-HFDISHLFHKWMKQKSSDKMIKIEITNSNTQNVINALSVLRNAPNFDVMVFQPN--------- 147

  Fly   474 INCSSGMTE---CCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKI 535
             ..::|.::   ||....|::|.:|||::|||.|.|:.|..|        |.|..::....:.:.
 Worm   148 -TVTAGTSDCVGCCVIPFYVNFTEIGWNDWILSPPGFYANVC--------SDTVCSTESDEVYQF 203

  Fly   536 LSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            :..:.::..   .|.|....|.|:.::|..|........:..:...||.|
 Worm   204 MKAAISDLP---EPKCAPNYYGSVDMIVALSPRDIRKTRVHGLRALSCSC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 35/178 (20%)
TGF_beta 481..585 CDD:278448 24/106 (23%)
tig-3NP_497318.2 TGF_beta_INHB 159..250 CDD:381630 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.