DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and MSTN

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_005250.1 Gene:MSTN / 2660 HGNCID:4223 Length:375 Species:Homo sapiens


Alignment Length:390 Identity:99/390 - (25%)
Similarity:166/390 - (42%) Gaps:64/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 AGGCPKCESNRQVEHITEEQLTHL----------RIEFVKQQILEKLRLKESPKVS----AVELP 277
            ||.....|::.|.|::.:|.|.:.          |||.:|.|||.||||:.:|.:|    ...||
Human    18 AGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLP 82

  Fly   278 K-----PIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFKI 337
            |     .:.|...:...|.|..:.|.|||:|.|  :.|:....|.:.....|||  |..|| ||.
Human    83 KAPPLRELIDQYDVQRDDSSDGSLEDDDYHATT--ETIITMPTESDFLMQVDGK--PKCCF-FKF 142

  Fly   338 DDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVE-VDQQKDSKYLSAAKTIAIQ 401
             .:..:...|..|.||::           :.......|:.|..:. :...||....:..:::.:.
Human   143 -SSKIQYNKVVKAQLWIY-----------LRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLD 195

  Fly   402 SVNVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEE---IISV------DKDYRPFI 457
            .......|..||::..:::|:...| |:|      |.::..::|   .::|      :....||:
Human   196 MNPGTGIWQSIDVKTVLQNWLKQPE-SNL------GIEIKALDENGHDLAVTFPGPGEDGLNPFL 253

  Fly   458 VIDMQNRRRKSRQKRSINCSSGMTE--CCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVA 520
            .:.:.:..::||:...::|....||  |||..|.:.|...|| :||:.|:.|.|.:|.|.|..| 
Human   254 EVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGW-DWIIAPKRYKANYCSGECEFV- 316

  Fly   521 SVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
             ..|...|...:.:      ||......||||..:.|.:.::..:.........:|.|||:.|||
Human   317 -FLQKYPHTHLVHQ------ANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGC 374

  Fly   586  585
            Human   375  374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 57/242 (24%)
TGF_beta 481..585 CDD:278448 32/105 (30%)
MSTNNP_005250.1 TGFb_propeptide 39..249 CDD:279078 53/233 (23%)
TGFB 281..375 CDD:214556 32/103 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12221
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.