DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_058801.1 Gene:Bmp3 / 25667 RGDID:2212 Length:468 Species:Rattus norvegicus


Alignment Length:121 Identity:42/121 - (34%)
Similarity:67/121 - (55%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 RKSRQKRSINCSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHS 530
            :|:|:|:.|.    ...|.|.:|.:.|.|||||.||:.|:.::||:|.|:|......:...|:|:
  Rat   353 KKARRKQWIE----PRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHA 413

  Fly   531 SIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586
            :|..|:...|....:. .|||..::.|||.::..|.:....:|..|||.|:||.||
  Rat   414 TIQSIVRAVGVVSGIP-EPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078
TGF_beta 481..585 CDD:278448 36/103 (35%)
Bmp3NP_058801.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
TGFb_propeptide 46..>203 CDD:279078
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..93
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..349
TGF_beta 364..467 CDD:278448 36/103 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.