DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf5

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_003749648.1 Gene:Gdf5 / 252835 RGDID:620102 Length:495 Species:Rattus norvegicus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:167/405 - (41%) Gaps:73/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QQPETPIEPELPLGERNIT-----ISVKSSAGGCPKCESNRQVEHITEEQLTHLRIEFV------ 255
            ::|.||.||:.|.....||     :|:..:.....:...|..|:  .|..|.:....|:      
  Rat   144 REPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRKGGNSSVK--LEAGLANTITSFIDKGQDD 206

  Fly   256 KQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNRE--EVE 318
            :..::.|.|....  :||:|.     ||: |.......:.|.||     .:|..:..:..  :::
  Rat   207 RGPVVRKQRYVFD--ISALEK-----DGL-LGAELRILRKKPLD-----VAKPAVPSSGRVAQLK 258

  Fly   319 CNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLW-LFKNKQNRTDTASVNSTSAQQTIVVSEVE 382
            .:....|:...::.....:...|..|::|..  :| ||:|.:|          |||..:.:...|
  Rat   259 LSSCPSGRQPAALLDVRSVPGLDGSGWEVFD--IWKLFRNFKN----------SAQLCLELEAWE 311

  Fly   383 VDQQKDSKYLS---AAKTIAIQSV-NVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDM 443
            ..:..|.:.|.   ||:.:..::: .|.....|.|:            ..:.|:...|..|.:..
  Rat   312 RGRAVDLRGLGFERAARQVHEKALFLVFGRTKKRDL------------FFNEIKARSGQDDKTVY 364

  Fly   444 EEIISVDKDYRPFIVIDMQNRRRKSRQKRSINCSSGMTECCREHLYISFRDIGWSNWILKPEGYN 508
            |.:.|..:..|    ..:.||:.| |..:::.     ..|.|:.|:::|:|:||.:||:.|..|.
  Rat   365 EYLFSQRRKRR----APLANRQGK-RPSKNLK-----ARCSRKALHVNFKDMGWDDWIIAPLEYE 419

  Fly   509 AYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVP--CCTAKQYSSLQLVVMDSSNTAT 571
            |:.|.|.|..........::|:.|..::::...    |..|  ||...:.|.:.::.:||:|...
  Rat   420 AFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDP----ESTPPTCCVPTRLSPISILFIDSANNVV 480

  Fly   572 VKTLPNMVVESCGCR 586
            .|...:|||||||||
  Rat   481 YKQYEDMVVESCGCR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 41/226 (18%)
TGF_beta 481..585 CDD:278448 32/105 (30%)
Gdf5XP_003749648.1 TGFb_propeptide 147..338 CDD:413528 42/217 (19%)
TGF_beta_GDF5 393..495 CDD:381669 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.