DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf6

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_038554.1 Gene:Gdf6 / 242316 MGIID:95689 Length:454 Species:Mus musculus


Alignment Length:126 Identity:36/126 - (28%)
Similarity:63/126 - (50%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 NRRRKSRQKRSINCSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAAS 527
            :|..|...|:|      ...|.|:.|:::|:::||.:||:.|..|.||.|.|.|..........:
Mouse   339 SRHGKRHGKKS------RLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPT 397

  Fly   528 HHSSIMKILSTSGANKSLELVP--CCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586
            :|:.|..::::.....:    |  ||...:.:.:.::.:|:.|....|...:|||||||||
Mouse   398 NHAIIQTLMNSMDPGST----PPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078
TGF_beta 481..585 CDD:278448 29/105 (28%)
Gdf6NP_038554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..93
TGFb_propeptide 75..284 CDD:279078
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..268
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..350 4/16 (25%)
TGF_beta 352..453 CDD:278448 29/104 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.