DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Tgfb3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_033394.2 Gene:Tgfb3 / 21809 MGIID:98727 Length:412 Species:Mus musculus


Alignment Length:407 Identity:95/407 - (23%)
Similarity:169/407 - (41%) Gaps:91/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 HITEEQLTHLRIEFVKQQILEKLRLKESPKVSAV-ELP----------KPIFDGMTLSHPDDSTK 294
            ||.::     |:|.::.|||.||||...|:.|.: .:|          :.:.:.|.....:..|:
Mouse    34 HIKKK-----RVEAIRGQILSKLRLTSPPEPSVMTHVPYQVLALYNSTRELLEEMHGEREEGCTQ 93

  Fly   295 NKELDDYYARTSKKFILL-----NREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWL 354
            .....:|||:...||.::     :.|...|     .|...|..|.|.:...:..|.:       |
Mouse    94 ETSESEYYAKEIHKFDMIQGLAEHNELAVC-----PKGITSKVFRFNVSSVEKNGTN-------L 146

  Fly   355 FKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQD--EWMKIDIEWP 417
            |:.:.......:.:|...:|.|.:.::    .:..::::..:.|..:::..:.  ||:..|:...
Mouse   147 FRAEFRVLRVPNPSSKRTEQRIELFQI----LRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDT 207

  Fly   418 IKHWISGHELSHL---IQITC-------GGCDVSDMEEIISV---------------------DK 451
            ::.|:...| |:|   |.|.|       .|..:.::.|::.:                     .|
Mouse   208 VREWLLRRE-SNLGLEISIHCPCHTFQPNGDILENVHEVMEIKFKGVDNEDDHGRGDLGRLKKQK 271

  Fly   452 D-YRPFIVIDM----------QNRRRKSRQKRSINCSSGMTE-CCREHLYISFR-DIGWSNWILK 503
            | :.|.:::.|          |..:||.|...:..|...:.| ||...|||.|| |:|| .|:.:
Mouse   272 DHHNPHLILMMIPPHRLDSPGQGSQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGW-KWVHE 335

  Fly   504 PEGYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSN 568
            |:||.|.||.|.|..:.|   |.:.||:::.:.:|  .|......|||..:....|.::.. ...
Mouse   336 PKGYYANFCSGPCPYLRS---ADTTHSTVLGLYNT--LNPEASASPCCVPQDLEPLTILYY-VGR 394

  Fly   569 TATVKTLPNMVVESCGC 585
            |..|:.|.||||:||.|
Mouse   395 TPKVEQLSNMVVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 47/263 (18%)
TGF_beta 481..585 CDD:278448 39/105 (37%)
Tgfb3NP_033394.2 TGFb_propeptide 24..230 CDD:366248 44/217 (20%)
TGF_beta_TGFB3 312..412 CDD:381656 40/107 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.