DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Tgfb2

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001316036.1 Gene:Tgfb2 / 21808 MGIID:98726 Length:442 Species:Mus musculus


Alignment Length:441 Identity:102/441 - (23%)
Similarity:165/441 - (37%) Gaps:129/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EQLTHLRIEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPD-----DSTKN--------- 295
            :|....|||.::.|||.||:|...|:    :.|:|  |.:.   |:     :||::         
Mouse    30 DQFMRKRIEAIRGQILSKLKLTSPPE----DYPEP--DEVP---PEVISIYNSTRDLLQEKASRR 85

  Fly   296 -------KELDDYYARTSKKFILLNREEVE----------------CNRARDGKSNPSMCF---- 333
                   :..::|||:...|..:.:....|                |:|     .:..:|.    
Mouse    86 AAACERERSDEEYYAKEVYKIDMPSHLPSETVCPVVTTPSGSLGSFCSR-----QSQVLCGYLDA 145

  Fly   334 ---TFKIDDADAEGFDVSTAVLWLFKNKQN--RTDTASVNSTSAQQTIVVSEVEVDQQKDSKYLS 393
               ||.........|||||    :.||..|  :.:.......:.:..:....:|:.|...||.|:
Mouse   146 IPPTFYRPYFRIVRFDVST----MEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLT 206

  Fly   394 AAKTIAIQS----VNVQDEWMKIDIEWPIKHWI--SGHELSHLIQITCGGCDV------------ 440
            :.....|.|    ...:.||:..|:...::.|:  ....|...|.:.|..|..            
Mouse   207 SPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKS 271

  Fly   441 ------------------SDMEEIISVDK---------------DYRPFIVIDMQNRRRKSRQKR 472
                              .|.:.|.|..|               .||   :...|:.|||.|...
Mouse   272 EELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKTPHLLLMLLPSYR---LESQQSSRRKKRALD 333

  Fly   473 SINCSSGMTE-CCREHLYISF-RDIGWSNWILKPEGYNAYFCRGSCSSV-ASVTQAASHHSSIMK 534
            :..|...:.: ||...|||.| ||:|| .||.:|:||||.||.|:|..: :|.||    |:.::.
Mouse   334 AAYCFRNVQDNCCLRPLYIDFKRDLGW-KWIHEPKGYNANFCAGACPYLWSSDTQ----HTKVLS 393

  Fly   535 ILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            :.:|  .|......|||.::....|.::.. ..||..::.|.||:|:||.|
Mouse   394 LYNT--INPEASASPCCVSQDLEPLTILYY-IGNTPKIEQLSNMIVKSCKC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 56/309 (18%)
TGF_beta 481..585 CDD:278448 39/106 (37%)
Tgfb2NP_001316036.1 TGFb_propeptide 21..256 CDD:279078 49/243 (20%)
TGF_beta 344..441 CDD:278448 39/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.