DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Mcm3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_032589.1 Gene:Mcm3 / 17215 MGIID:101845 Length:812 Species:Mus musculus


Alignment Length:159 Identity:34/159 - (21%)
Similarity:59/159 - (37%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 IEFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREE 316
            :|.|:....:|:..||..:..|.|      |...|.  |:..|::| |....|..:|        
Mouse   646 VELVQYAYFKKVLEKEKKRKKASE------DESDLE--DEEEKSQE-DTEQKRKRRK-------- 693

  Fly   317 VECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEV 381
               ..|:||:|              .:.:|.|.|...:.:....:||.:...:..:|:|....:|
Mouse   694 ---THAKDGES--------------YDPYDFSEAETQMPQVHTPKTDDSQEKTDDSQETQDSQKV 741

  Fly   382 EVDQQKDSKYLSAAKTIAIQSVNVQDEWM 410
            |:.:.: .|...||.....|..:.|...|
Mouse   742 ELSEPR-LKAFKAALLEVFQEAHEQSVGM 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 34/159 (21%)
TGF_beta 481..585 CDD:278448
Mcm3NP_032589.1 MCM_N 17..129 CDD:291233
MCM 109..654 CDD:214631 2/7 (29%)
P-loop_NTPase 340..479 CDD:304359
Arginine finger 477..480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..744 23/113 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.807993 Normalized mean entropy S5
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.