DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_032134.2 Gene:Gdf3 / 14562 MGIID:95686 Length:366 Species:Mus musculus


Alignment Length:405 Identity:77/405 - (19%)
Similarity:143/405 - (35%) Gaps:135/405 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 EFVKQQILEKLRLKESPKVSAVELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREEV 317
            ||....:|:.|.|:::|.....: |.|                        |..:|.|       
Mouse    24 EFQDSDLLQFLGLEKAPSPHRFQ-PVP------------------------RVLRKII------- 56

  Fly   318 ECNRARDGK----SNPSMCFTFK----------IDDADAEGFDVSTAVLWLFKNKQNRTDTAS-- 366
               |||:..    ::..:|:..:          :.|   :||         |.|.|......|  
Mouse    57 ---RAREAAAASGASQDLCYVKELGVRGNLLQLLPD---QGF---------FLNTQKPFQDGSCL 106

  Fly   367 -------VNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQDE--W------------- 409
                   :::...:..:.::::.:|....|.|....:.:...|| |||.  |             
Mouse   107 QKVLYFNLSAIKEKAKLTMAQLTLDLGPRSYYNLRPELVVALSV-VQDRGVWGRSHPKVGRLLFL 170

  Fly   410 ---------MKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEEIISVDKDYRPFIVIDMQNR- 464
                     ::.:::..:|.| |.:.|.:|           |:...|.|.:|....:.:..:|. 
Mouse   171 RSVPGPQGQLQFNLQGALKDW-SSNRLKNL-----------DLHLEILVKEDRYSRVTVQPENPC 223

  Fly   465 ---------------------RRKSRQKR-SINCSSGMTE--CCREHLYISFRDIGWSNWILKPE 505
                                 ...||::| :|:...|...  |.|..|:|:|:|:||..|::.|:
Mouse   224 DRLLRSLHASLLVVTLNPKHCHPSSRKRRAAISVPKGFCRNFCHRHQLFINFQDLGWHKWVIAPK 288

  Fly   506 GYNAYFCRGSCSSVASVTQAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTA 570
            |:.|.:|.|.| ..:..|...|.:.:.|:.|......|..:.|  |...:.|.:.::..||....
Mouse   289 GFMANYCHGEC-PFSMTTYLNSSNYAFMQALMHMADPKVPKAV--CVPTKLSPISMLYQDSDKNV 350

  Fly   571 TVKTLPNMVVESCGC 585
            .::...:|||:.|||
Mouse   351 ILRHYEDMVVDECGC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 40/251 (16%)
TGF_beta 481..585 CDD:278448 29/105 (28%)
Gdf3NP_032134.2 TGFb_propeptide <110..204 CDD:279078 15/106 (14%)
TGFB 266..366 CDD:214556 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.