DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Gdf1

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001156754.1 Gene:Gdf1 / 14559 MGIID:95683 Length:357 Species:Mus musculus


Alignment Length:112 Identity:33/112 - (29%)
Similarity:61/112 - (54%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 CCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVT----QAASHHSSIMKIL----STS 539
            |....|::|||::||..|::.|.|:.|.||:|:|:...::.    ..|.:|:.:..::    .|.
Mouse   251 CRTRRLHVSFREVGWHRWVIAPRGFLANFCQGTCALPETLRGPGGPPALNHAVLRALMHAAAPTP 315

  Fly   540 GANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586
            ||..     |||..::.|.:.::..|:|:...::...:|||:.||||
Mouse   316 GAGS-----PCCVPERLSPISVLFFDNSDNVVLRHYEDMVVDECGCR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078
TGF_beta 481..585 CDD:278448 30/109 (28%)
Gdf1NP_001156754.1 TGFb_propeptide 36..>141 CDD:279078
TGFB 251..357 CDD:214556 31/110 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.