DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and LOC1277335

DIOPT Version :10

Sequence 1:NP_523461.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_061517601.1 Gene:LOC1277335 / 1277335 VectorBaseID:AGAMI1_002639 Length:444 Species:Anopheles gambiae


Alignment Length:124 Identity:29/124 - (23%)
Similarity:45/124 - (36%) Gaps:35/124 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NDEVR---VKVHYC-------------------SLNTTDVKIIAGKH----AELNVPLPFIPGHE 95
            |||||   .|:|..                   ||....|.|:|..|    .:||..:..|.|..
Mosquito    41 NDEVREFYEKMHLMEVGEENAFIHNAYFYSNSKSLGKNAVAIVATMHKDAVTDLNDFILKIVGTN 105

  Fly    96 FSGEIVEIG----QDNPHHFNRGDRVVVMNDLQDPNGGLISEAVVKNRD-VWTVPQSVP 149
            .:...|..|    :.||....:...|::..:..|.    :|:..::.|: :.|.|.|.|
Mosquito   106 STNRFVTDGKLTTEQNPDESCKYTTVLIQTNTLDS----MSKLEIETRNGLVTFPFSEP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_523461.1 TGF_beta_INHB 483..585 CDD:381630
LOC1277335XP_061517601.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.