DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp8a

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001242948.1 Gene:Bmp8a / 12163 MGIID:104515 Length:412 Species:Mus musculus


Alignment Length:298 Identity:76/298 - (25%)
Similarity:131/298 - (43%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 FTFKIDDADAEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKT 397
            |.|.:....| |..|:.|...::|    ...|..:|:     |:.:|..||.|:..::. |....
Mouse   125 FHFDLTQIPA-GEAVTAAEFRIYK----EPSTHPLNT-----TLHISMFEVVQEHSNRE-SDLFF 178

  Fly   398 IAIQSVNVQDE-WMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEEIIS------VDKDYRP 455
            :.:|::...|| |:.:||......|:..|.....:::.....|...|:..::      ..:..:|
Mouse   179 LDLQTLRSGDEGWLVLDITAASDRWLLNHHKDLGLRLYVETADGHSMDPGLAGLLGRQAPRSRQP 243

  Fly   456 FIVIDMQ-----------NRRRKSRQKRSIN----------------CSSGMTECCREHLYISFR 493
            |:|...:           .|..|.||.:..|                .|.|...|.|..||:|||
Mouse   244 FMVTF
FRASQSPVRAPRAARPLKRRQPKKTNELPHPNKLPGIFDDGHGSRGREVCRRHELYVSFR 308

  Fly   494 DIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHSSIMKILST--------SGAN-KSLELVP 549
            |:||.:|::.|:||:||:|.|.|:........|::|:.:..::||        ||.: ...::||
Mouse   309 DLGWLDWVIAPQGYSAYYCEGECAFPLDSCMNATNHAILQSLVSTTVACCDRWSGVHLMKPDVVP 373

  Fly   550 --CCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
              ||...:.|:..::..||||...::...||||::|||
Mouse   374 KACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 27/131 (21%)
TGF_beta 481..585 CDD:278448 39/114 (34%)
Bmp8aNP_001242948.1 TGFb_propeptide 32..248 CDD:279078 28/133 (21%)
TGF_beta 298..411 CDD:278448 39/112 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.